Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Interleukin-9 receptor (IL9R), partial

Product Specifications

Product Name Alternative

IL-9 receptor; IL-9R; CD129

Abbreviation

Recombinant Human IL9R protein, partial

Gene Name

IL9R

UniProt

Q01113

Expression Region

41-270aa

Organism

Homo sapiens (Human)

Target Sequence

SVTGEGQGPRSRTFTCLTNNILRIDCHWSAPELGQGSSPWLLFTSNQAPGGTHKCILRGSECTVVLPPEAVLVPSDNFTITFHHCMSGREQVSLVDPEYLPRRHVKLDPPSDLQSNISSGHCILTWSISPALEPMTTLLSYELAFKKQEEAWEQAQHRDHIVGVTWLILEAFELDPGFIHEARLRVQMATLEDDVVEEERYTGQWSEWSQPVCFQAPQRQGPLIPPWGWP

Tag

C-terminal hFc1-tagged

Type

Developed Protein

Source

Mammalian cell

Field of Research

Others

Relevance

Plays an important role in the immune response against parasites by acting as a receptor of IL9

Endotoxin

Not test

Purity

Greater than 95% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

54.8 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Partial

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Escherichia coli O6:K15:H31 Citrate lyase acyl carrier protein (citD)
MBS1413134-01 0.02 mg (E-Coli)

Recombinant Escherichia coli O6:K15:H31 Citrate lyase acyl carrier protein (citD)

Sign In for Pricing
View Details
Recombinant Escherichia coli O6:K15:H31 Citrate lyase acyl carrier protein (citD)
MBS1413134-02 0.1 mg (E-Coli)

Recombinant Escherichia coli O6:K15:H31 Citrate lyase acyl carrier protein (citD)

Sign In for Pricing
View Details
Recombinant Escherichia coli O6:K15:H31 Citrate lyase acyl carrier protein (citD)
MBS1413134-03 0.02 mg (Yeast)

Recombinant Escherichia coli O6:K15:H31 Citrate lyase acyl carrier protein (citD)

Sign In for Pricing
View Details
Recombinant Escherichia coli O6:K15:H31 Citrate lyase acyl carrier protein (citD)
MBS1413134-04 0.1 mg (Yeast)

Recombinant Escherichia coli O6:K15:H31 Citrate lyase acyl carrier protein (citD)

Sign In for Pricing
View Details
Recombinant Escherichia coli O6:K15:H31 Citrate lyase acyl carrier protein (citD)
MBS1413134-05 0.02 mg (Baculovirus)

Recombinant Escherichia coli O6:K15:H31 Citrate lyase acyl carrier protein (citD)

Sign In for Pricing
View Details
Recombinant Escherichia coli O6:K15:H31 Citrate lyase acyl carrier protein (citD)
MBS1413134-06 1 mg (E-Coli)

Recombinant Escherichia coli O6:K15:H31 Citrate lyase acyl carrier protein (citD)

Sign In for Pricing
View Details