Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse T-cell surface glycoprotein CD5 (Cd5), partial

Product Specifications

Product Name Alternative

Lymphocyte antigen 1

Abbreviation

Recombinant Mouse Cd5 protein, partial

Gene Name

Cd5

UniProt

P13379

Expression Region

24-371aa

Organism

Mus musculus (Mouse)

Target Sequence

QSGRGGLDIQVMLSGSNSKCQGQVEIQMENKWKTVCSSSWRLSQDHSKNAQQASAVCKQLRCGDPLALGPFPSLNRPQNQVFCQGSPWSISNCNNTSSQDQCLPLSLICLEPQRTTPPPTTTPPTTVPEPTAPPRLQLVPGHEGLRCTGVVEFYNGSWGGTILYKAKDRPLGLGNLICKSLQCGSFLTHLSGTEAAGTPAPAELRDPRPLPIRWEAPNGSCVSLQQCFQKTTAQEGGQALTVICSDFQPKVQSRLVGGSSVCEGIAEVRQRSQWEALCDSSAARGRGRWEELCREQQCGDLISFHTVDADKTSPGFLCAQEKLSQCYHLQKKKHCNKRVFVTCQDPNP

Tag

C-terminal 10xHis-tagged

Type

Developed Protein

Source

Mammalian cell

Field of Research

Immunology

Relevance

Lymphoid-specific receptor expressed by all T-cells and in a subset of B-cells known as B1a cells. Plays a role in the regulation of TCR and BCR signaling, thymocyte selection, T-cell effector differentiation and immune tolerance. Acts by interacting with several ligands expressed on B-cells such as CD5L or CD72 and thereby plays an important role in contact-mediated, T-dependent B-cell activation and in the maintenance of regulatory T and B-cell homeostasis. Functions as a negative regulator of TCR signaling during thymocyte development by associating with several signaling proteins including LCK, CD3Z chain, PI3K or CBL. Mechanistically, co-engagement of CD3 with CD5 enhances phosphorylated CBL recruitment leading to increased VAV1 phosphorylation and degradation. Modulates B-cell biology through ERK1/2 activation in a Ca (2+) -dependent pathway via the non-selective Ca (2+) channel TRPC1, leading to IL-10 production

Endotoxin

Not test

Purity

Greater than 95% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

39.3 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Partial

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PCDHGC5 (NM_018929) Human Over-expression Lysate
LS056097-100ug 100 µg

PCDHGC5 (NM_018929) Human Over-expression Lysate

Sign In for Pricing
View Details
Lentiviral human MAPK10 shRNA (UAS) - Lentiviral human MAPK10 shRNA (UAS, iRFP) (100)
GTR15324930 1 Vial

Lentiviral human MAPK10 shRNA (UAS) - Lentiviral human MAPK10 shRNA (UAS, iRFP) (100)

Sign In for Pricing
View Details
Meis1 (NM_010789) Mouse Tagged ORF Clone Lentiviral Particle
MR225804L2V 200 µL

Meis1 (NM_010789) Mouse Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
Recombinant Sinorhizobium medicae Recombination protein RecR (recR)
MBS1071013-01 0.02 mg (E-Coli)

Recombinant Sinorhizobium medicae Recombination protein RecR (recR)

Sign In for Pricing
View Details
Recombinant Sinorhizobium medicae Recombination protein RecR (recR)
MBS1071013-02 0.1 mg (E-Coli)

Recombinant Sinorhizobium medicae Recombination protein RecR (recR)

Sign In for Pricing
View Details
Recombinant Sinorhizobium medicae Recombination protein RecR (recR)
MBS1071013-03 0.02 mg (Yeast)

Recombinant Sinorhizobium medicae Recombination protein RecR (recR)

Sign In for Pricing
View Details