Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Early activation antigen CD69 (CD69), partial

Product Specifications

Product Name Alternative

Activation inducer molecule; BL-AC/P26; C-type lectin domain family 2 member C; EA1; Early T-cell activation antigen p60; GP32/28; Leukocyte surface antigen Leu-23; MLR-3

Abbreviation

Recombinant Human CD69 protein, partial

Gene Name

CD69

UniProt

Q07108

Expression Region

62-199aa

Organism

Homo sapiens (Human)

Target Sequence

SVGQYNCPGQYTFSMPSDSHVSSCSEDWVGYQRKCYFISTVKRSWTSAQNACSEHGATLAVIDSEKDMNFLKRYAGREEHWVGLKKEPGHPWKWSNGKEFNNWFNVTGSDKCVFLKNTEVSSMECEKNLYWICNKPYK

Tag

C-terminal mFc2a-tagged

Type

Developed Protein

Source

Mammalian cell

Field of Research

Immunology

Relevance

Transmembrane protein expressed mainly on T-cells resident in mucosa that plays an essential role in immune cell homeostasis. Rapidly expressed on the surface of platelets, T-lymphocytes and NK cells upon activation by various stimuli, such as antigen recognition or cytokine signaling, stimulates different signaling pathways in different cell types. Negatively regulates Th17 cell differentiation through its carbohydrate dependent interaction with galectin-1/LGALS1 present on immature dendritic cells. Association of CD69 cytoplasmic tail with the JAK3/STAT5 signaling pathway regulates the transcription of RORgamma/RORC and, consequently, differentiation toward the Th17 lineage. Also acts via the S100A8/S100A9 complex present on peripheral blood mononuclear cells to promote the conversion of naive CD4 T-cells into regulatory T-cells. Acts as an oxidized low-density lipoprotein (oxLDL) receptor in CD4 T-lymphocytes and negatively regulates the inflammatory response by inducing the expression of PDCD1 through the activation of NFAT. Participates in adipose tissue-derived mesenchymal stem cells (ASCs) -mediated protection against P.aeruginosa infection. Mechanistically, specifically recognizes P.aeruginosa to promote ERK1 activation, followed by granulocyte-macrophage colony-stimulating factor (GM-CSF) and other inflammatory cytokines secretion. In eosinophils, induces IL-10 production through the ERK1/2 pathway. Negatively regulates the chemotactic responses of effector lymphocytes and dendritic cells (DCs) to sphingosine 1 phosphate/S1P by acting as a S1PR1 receptor agonist and facilitating the internalization and degradation of the receptor

Endotoxin

Not test

Purity

Greater than 95% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

45.3 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Partial

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MAP2 Antibody (phospho-S1539)
F48609-0.08ML 0.08 mL

MAP2 Antibody (phospho-S1539)

Sign In for Pricing
View Details
Human RBM45 activation kit by CRISPRa
GA115094 1 Kit

Human RBM45 activation kit by CRISPRa

Sign In for Pricing
View Details
SMAD3 Mouse Monoclonal Antibody [Clone ID: 5G11]
AM06479SU-N 100 µL

SMAD3 Mouse Monoclonal Antibody [Clone ID: 5G11]

Sign In for Pricing
View Details
Tissue FFPE Sections, Prostate
CS703752 5x 5 µm

Tissue FFPE Sections, Prostate

Sign In for Pricing
View Details
1-Hydroxy-alpha-Phenylcyclopentaneacetic Acid
TRC-C909630-50MG 50 mg

1-Hydroxy-alpha-Phenylcyclopentaneacetic Acid

Sign In for Pricing
View Details
TNFAIP3 Human Gene Knockout Kit (CRISPR)
KN221337BN 1 Kit

TNFAIP3 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details