Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Macaca mulatta Epithelial cell adhesion molecule (TACSTD1), partial, Biotinylated

Product Specifications

Product Name Alternative

Tumor-associated calcium signal transducer 1

Abbreviation

Recombinant Rhesus macaque TACSTD1 protein, partial, Biotinylated

Gene Name

TACSTD1

UniProt

Q1WER1

Expression Region

24-265aa

Organism

Macaca mulatta (Rhesus macaque)

Target Sequence

QKECVCENYKLAVNCFLNDNGQCQCTSIGAQNTVLCSKLAAKCLVMKAEMNGSKLGRRAKPEGALQNNDGLYDPDCDESGLFKAKQCNGTSTCWCVNTAGVRRTDKDTEITCSERVRTYWIIIELKHKAREKPYDVQSLRTALEEAIKTRYQLDPKFITNILYEDNVITIDLVQNSSQKTQNDVDIADVAYYFEKDVKGESLFHSKKMDLRVNGEQLDLDPGQTLIYYVDEKAPEFSMQGLK

Tag

C-terminal 10xHis-G4S-Avi-tagged

Type

Developed Protein

Source

Mammalian cell

Field of Research

Others

Relevance

May act as a physical homophilic interaction molecule between intestinal epithelial cells (IECs) and intraepithelial lymphocytes (IELs) at the mucosal epithelium for providing immunological barrier as a first line of defense against mucosal infection. Plays a role in embryonic stem cells proliferation and differentiation. Up-regulates the expression of FABP5, MYC and cyclins A and E

Endotoxin

Not test

Purity

Greater than 95% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

30.9 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Partial

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

P/P075/NL532-ALU-297X420/1 Prohibited Activity Signs (No Adhesive)
321806 1 Pack (1 Panel (s) x 1 Pack)

P/P075/NL532-ALU-297X420/1 Prohibited Activity Signs (No Adhesive)

Sign In for Pricing
View Details
MBL Bulb Pipette 20ml Class B
PIP1114-01 1 Each

MBL Bulb Pipette 20ml Class B

Sign In for Pricing
View Details
MBL Bulb Pipette 20ml Class B
PIP1114-02 5 / PCK

MBL Bulb Pipette 20ml Class B

Sign In for Pricing
View Details
Obg Antibody
orb818526 2 mg

Obg Antibody

Sign In for Pricing
View Details
ICP Std Mercury 10ug/mL in 5% HNO3
PHG10C3 50 mL

ICP Std Mercury 10ug/mL in 5% HNO3

Sign In for Pricing
View Details
BRS3 antibody
MBS535673-01 0.05 mg

BRS3 antibody

Sign In for Pricing
View Details