Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Influenza A virus Matrix protein 2 (M)

Product Specifications

Product Name Alternative

Proton channel protein M2

Abbreviation

Recombinant Influenza A virus M protein

Gene Name

M

UniProt

Q289M6

Expression Region

1-96aa

Organism

Influenza A virus (strain A/New Zealand:South Canterbury/35/2000 H1N1)

Target Sequence

MSLLTEVETPIRNEWGCRCNDSSDPLVVAASIIGIVHLILWIIDRLFSKSIYRIFKHGLKRGPSTEGVPESMREEYREEQQNAVDADDGHFVSIEL

Tag

C-terminal 6xHis-tagged

Type

Developed Protein

Source

In vitro E.coli expression system

Field of Research

Others

Relevance

Forms a proton-selective ion channel that is necessary for the efficient release of the viral genome during virus entry. After attaching to the cell surface, the virion enters the cell by endocytosis. Acidification of the endosome triggers M2 ion channel activity. The influx of protons into virion interior is believed to disrupt interactions between the viral ribonucleoprotein (RNP), matrix protein 1 (M1), and lipid bilayers, thereby freeing the viral genome from interaction with viral proteins and enabling RNA segments to migrate to the host cell nucleus, where influenza virus RNA transcription and replication occur. Also plays a role in viral proteins secretory pathway. Elevates the intravesicular pH of normally acidic compartments, such as trans-Golgi network, preventing newly formed hemagglutinin from premature switching to the fusion-active conformation

Endotoxin

Not test

Purity

Greater than 95% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

11.9 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Transmembrane Domains

1TM

Protein Length

Full Length

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PSMA5 Rabbit Polyclonal Antibody
ER2001-68 100 µL

PSMA5 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Snap25 Mouse Gene Knockout Kit (CRISPR)
KN516371 1 Kit

Snap25 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
L-Formiminoglutamic Acid
TRC-F735558-5MG 5 mg

L-Formiminoglutamic Acid

Sign In for Pricing
View Details
Frozen Tissue Sections, Lung
CS626803 5x 5 µm

Frozen Tissue Sections, Lung

Sign In for Pricing
View Details
Mannose Receptor (CD206) Recombinant Rabbit monoclonal Antibody
HA751188 100 µL

Mannose Receptor (CD206) Recombinant Rabbit monoclonal Antibody

Sign In for Pricing
View Details
C15orf44 (VWA9) Human Gene Knockout Kit (CRISPR)
KN401412 1 Kit

C15orf44 (VWA9) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details