Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Prostate stem cell antigen (PSCA)

Product Specifications

Product Name Alternative

PSCA; UNQ206/PRO232

Abbreviation

Recombinant Human PSCA protein

Gene Name

PSCA

UniProt

O43653

Expression Region

12-86aa

Organism

Homo sapiens (Human)

Target Sequence

LLCYSCKAQVSNEDCLQVENCTQLGEQCWTARIRAVGLLTVISKGCSLNCVDDSQDYYVGKKNITCCDTDLCNAS

Tag

C-terminal G4S-10xHis-tagged

Type

Developed Protein

Source

Mammalian cell

Field of Research

Others

Relevance

May be involved in the regulation of cell proliferation. Has a cell-proliferation inhibition activity in vitro

Endotoxin

Not test

Purity

Greater than 95% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

14.8 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Mature Protein

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GKN1 Antibody
orb1260587 100 µL

GKN1 Antibody

Sign In for Pricing
View Details
COL21A1, NT (COL21A1, COL1AL, Collagen alpha-1 (XXI) chain) (PE) discontinued
034090-PE 200 µL

COL21A1, NT (COL21A1, COL1AL, Collagen alpha-1 (XXI) chain) (PE) discontinued

Sign In for Pricing
View Details
Cy3-Linked Monoclonal Antibody to Dynein, Axonemal, Heavy Chain 11 (DNAH11)
MBS2146382-01 0.1 mL

Cy3-Linked Monoclonal Antibody to Dynein, Axonemal, Heavy Chain 11 (DNAH11)

Sign In for Pricing
View Details
Cy3-Linked Monoclonal Antibody to Dynein, Axonemal, Heavy Chain 11 (DNAH11)
MBS2146382-02 0.2 mL

Cy3-Linked Monoclonal Antibody to Dynein, Axonemal, Heavy Chain 11 (DNAH11)

Sign In for Pricing
View Details
Cy3-Linked Monoclonal Antibody to Dynein, Axonemal, Heavy Chain 11 (DNAH11)
MBS2146382-03 0.5 mL

Cy3-Linked Monoclonal Antibody to Dynein, Axonemal, Heavy Chain 11 (DNAH11)

Sign In for Pricing
View Details
Cy3-Linked Monoclonal Antibody to Dynein, Axonemal, Heavy Chain 11 (DNAH11)
MBS2146382-04 1 mL

Cy3-Linked Monoclonal Antibody to Dynein, Axonemal, Heavy Chain 11 (DNAH11)

Sign In for Pricing
View Details