Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Eukaryotic translation initiation factor 1A, Y-chromosomal (EIF1AY)

Product Specifications

Product Name Alternative

Eukaryotic translation initiation factor 4C

Abbreviation

Recombinant Human EIF1AY protein

Gene Name

EIF1AY

UniProt

O14602

Expression Region

2-144aa

Organism

Homo sapiens (Human)

Target Sequence

PKNKGKGGKNRRRGKNENESEKRELVFKEDGQEYAQVIKMLGNGRLEALCFDGVKRLCHIRGKLRKKVWINTSDIILVGLRDYQDNKADVILKYNADEARSLKAYGELPEHAKINETDTFGPGDDDEIQFDDIGDDDEDIDDI

Tag

N-terminal GST-tagged

Type

Developed Protein

Source

Mammalian cell

Field of Research

Cancer

Relevance

Component of the 43S pre-initiation complex (43S PIC), which binds to the mRNA cap-proximal region, scans mRNA 5'-untranslated region, and locates the initiation codon. This protein enhances formation of the cap-proximal complex. Together with EIF1, facilitates scanning, start codon recognition, promotion of the assembly of 48S complex at the initiation codon (43S PIC becomes 48S PIC after the start codon is reached), and dissociation of aberrant complexes. After start codon location, together with EIF5B orients the initiator methionine-tRNA in a conformation that allows 60S ribosomal subunit joining to form the 80S initiation complex. Is released after 80S initiation complex formation, just after GTP hydrolysis by EIF5B, and before release of EIF5B. Its globular part is located in the A site of the 40S ribosomal subunit. Its interaction with EIF5 during scanning contribute to the maintenance of EIF1 within the open 43S PIC. In contrast to yeast orthologs, does not bind EIF1

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

43.1 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Mature Protein

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

1,1,2-Trichloroethane
TRC-T773530-5G 5 g

1,1,2-Trichloroethane

Sign In for Pricing
View Details
OTUB2 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI6C7]
TA501973AM 100 µL

OTUB2 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI6C7]

Sign In for Pricing
View Details
TRIM44 antibody
FNab08987 100 µg

TRIM44 antibody

Sign In for Pricing
View Details
Juvenile Hormone B 3 (Mixture of Diastereomers), Technical Grade
TRC-J211205-10MG 10 mg

Juvenile Hormone B 3 (Mixture of Diastereomers), Technical Grade

Sign In for Pricing
View Details
Alizarin
TRC-A536600-1G 1 g

Alizarin

Sign In for Pricing
View Details
Tissue FFPE Sections, Prostate
CS706884 5x 5 µm

Tissue FFPE Sections, Prostate

Sign In for Pricing
View Details