Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Influenza A virus Polymerase basic protein 2 (PB2), partial

Product Specifications

Product Name Alternative

RNA-directed RNA polymerase subunit P3

Abbreviation

Recombinant Influenza A virus PB2 protein, partial

Gene Name

PB2

UniProt

P03428

Expression Region

318-484aa

Organism

Influenza A virus (strain A/Puerto Rico/8/1934 H1N1)

Target Sequence

RISSSFSFGGFTFKRTSGSSVKREEEVLTGNLQTLKIRVHEGYEEFTMVGRRATAILRKATRRLIQLIVSGRDEQSIAEAIIVAMVFSQEDCMIKAVRGDLNFVNRANQRLNPMHQLLRHFQKDAKVLFQNWGVEPIDNVMGMIGILPDMTPSIEMSMRGVRISKMG

Tag

C-terminal 6xHis-tagged

Type

Developed Protein

Source

E.coli

Field of Research

Others

Relevance

Plays an essential role in transcription initiation and cap-stealing mechanism, in which cellular capped pre-mRNAs are used to generate primers for viral transcription. Recognizes and binds the 7-methylguanosine-containing cap of the target pre-RNA which is subsequently cleaved after 10-13 nucleotides by the viral protein PA. Plays a role in the initiation of the viral genome replication and modulates the activity of the ribonucleoprotein (RNP) complex. In addition, participates in the inhibition of type I interferon induction through interaction with and inhibition of the host mitochondrial antiviral signaling protein MAVS

Endotoxin

Not test

Purity

Greater than 95% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

25.8 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Partial

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral human WBP2 shRNA (UAS) - Lentiviral human WBP2 shRNA (UAS) (100)
GTR15112230 1 Vial

Lentiviral human WBP2 shRNA (UAS) - Lentiviral human WBP2 shRNA (UAS) (100)

Sign In for Pricing
View Details
Goat ATP-sensitive inward rectifier potassium channel 8 (KCNJ8) ELISA Kit
MBS7229735-01 48 Well

Goat ATP-sensitive inward rectifier potassium channel 8 (KCNJ8) ELISA Kit

Sign In for Pricing
View Details
Goat ATP-sensitive inward rectifier potassium channel 8 (KCNJ8) ELISA Kit
MBS7229735-02 96 Well

Goat ATP-sensitive inward rectifier potassium channel 8 (KCNJ8) ELISA Kit

Sign In for Pricing
View Details
Goat ATP-sensitive inward rectifier potassium channel 8 (KCNJ8) ELISA Kit
MBS7229735-03 5x 96 Well

Goat ATP-sensitive inward rectifier potassium channel 8 (KCNJ8) ELISA Kit

Sign In for Pricing
View Details
Goat ATP-sensitive inward rectifier potassium channel 8 (KCNJ8) ELISA Kit
MBS7229735-04 10x 96 Well

Goat ATP-sensitive inward rectifier potassium channel 8 (KCNJ8) ELISA Kit

Sign In for Pricing
View Details
KDELR2 Antibody - middle region : Biotin (ARP67599_P050-Biotin)
ARP67599_P050-Biotin 100 µL

KDELR2 Antibody - middle region : Biotin (ARP67599_P050-Biotin)

Sign In for Pricing
View Details