Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Estrogen receptor (ESR1), partial

Product Specifications

Product Name Alternative

ER-alpha; Estradiol receptor; Nuclear receptor subfamily 3 group A member 1

Abbreviation

Recombinant Human ESR1 protein, partial

Gene Name

ESR1

UniProt

P03372

Expression Region

89-230aa

Organism

Homo sapiens (Human)

Target Sequence

FGSNGLGGFPPLNSVSPSPLMLLHPPPQLSPFLQPHGQQVPYYLENEPSGYTVREAGPPAFYRPNSDNRRQGGRERLASTNDKGSMAMESAKETRYCAVCNDYASGYHYGVWSCEGCKAFFKRSIQGHNDYMCPATNQCTID

Tag

N-terminal 6xHis-ABP-tagged

Type

Developed Protein

Source

E.coli

Field of Research

Transcription

Relevance

Nuclear hormone receptor. The steroid hormones and their receptors are involved in the regulation of eukaryotic gene expression and affect cellular proliferation and differentiation in target tissues. Ligand-dependent nuclear transactivation involves either direct homodimer binding to a palindromic estrogen response element (ERE) sequence or association with other DNA-binding transcription factors, such as AP-1/c-Jun, c-Fos, ATF-2, Sp1 and Sp3, to mediate ERE-independent signaling. Ligand binding induces a conformational change allowing subsequent or combinatorial association with multiprotein coactivator complexes through LXXLL motifs of their respective components. Mutual transrepression occurs between the estrogen receptor (ER) and NF-kappa-B in a cell-type specific manner. Decreases NF-kappa-B DNA-binding activity and inhibits NF-kappa-B-mediated transcription from the IL6 promoter and displace RELA/p65 and associated coregulators from the promoter. Recruited to the NF-kappa-B response element of the CCL2 and IL8 promoters and can displace CREBBP. Present with NF-kappa-B components RELA/p65 and NFKB1/p50 on ERE sequences. Can also act synergistically with NF-kappa-B to activate transcription involving respective recruitment adjacent response elements; the function involves CREBBP. Can activate the transcriptional activity of TFF1. Also mediates membrane-initiated estrogen signaling involving various kinase cascades. Essential for MTA1-mediated transcriptional regulation of BRCA1 and BCAS3. Maintains neuronal survival in response to ischemic reperfusion injury when in the presence of circulating estradiol (17-beta-estradiol/E2)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

22.5 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Partial

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human ZBTB37 activation kit by CRISPRa
GA113604 1 Kit

Human ZBTB37 activation kit by CRISPRa

Sign In for Pricing
View Details
MemBrite® Fix 680/700 Cell Surface Staining Kit, 100 Reactions
#30099-T 1 Kit

MemBrite® Fix 680/700 Cell Surface Staining Kit, 100 Reactions

Sign In for Pricing
View Details
13,16-Docosadienamide
TRC-D784830-25MG 25 mg

13,16-Docosadienamide

Sign In for Pricing
View Details
Gemin 2 (GEMIN2) (NM_001009183) Human Over-expression Lysate
LY422905 100 µg

Gemin 2 (GEMIN2) (NM_001009183) Human Over-expression Lysate

Sign In for Pricing
View Details
C1orf57 (NTPCR) Human Gene Knockout Kit (CRISPR)
KN403017 1 Kit

C1orf57 (NTPCR) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
AP2B1 (NM_001030006) Human Over-expression Lysate
LC422286 20 µg

AP2B1 (NM_001030006) Human Over-expression Lysate

Sign In for Pricing
View Details