Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Progesterone receptor (PGR), partial

Product Specifications

Product Name Alternative

Nuclear receptor subfamily 3 group C member 3; PR

Abbreviation

Recombinant Human PGR protein, partial

Gene Name

PGR

UniProt

P06401

Expression Region

323-419aa

Organism

Homo sapiens (Human)

Target Sequence

LLEDESYDGGAGAASAFAPPRSSPCASSTPVAVGDFPDCAYPPDAEPKDDAYPLYSDFQPPALKIKEEEEGAEASARSPRSYLVAGANPAAFPDFPL

Tag

N-terminal 6xHis-ABP-tagged

Type

Developed Protein

Source

E.coli

Field of Research

Others

Relevance

The steroid hormones and their receptors are involved in the regulation of eukaryotic gene expression and affect cellular proliferation and differentiation in target tissues. Depending on the isoform, progesterone receptor functions as a transcriptional activator or repressor

Endotoxin

Not test

Purity

Greater than 95% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

16.9 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Partial

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Ikzf1 Mouse shRNA Plasmid (Locus ID 22778)
TR502473 1 Kit

Ikzf1 Mouse shRNA Plasmid (Locus ID 22778)

Sign In for Pricing
View Details
Goat Interleukin 15 ELISA kit
GTR10378951 96 Well

Goat Interleukin 15 ELISA kit

Sign In for Pricing
View Details
Human Ryanodine receptor 2 ELISA Kit
MBS9427134-01 96 Tests

Human Ryanodine receptor 2 ELISA Kit

Sign In for Pricing
View Details
Human Ryanodine receptor 2 ELISA Kit
MBS9427134-02 5x 96 Tests

Human Ryanodine receptor 2 ELISA Kit

Sign In for Pricing
View Details
Purified Anti-Mouse CD103 Antibody[M290]
E-AB-F1090A-01 25 µg

Purified Anti-Mouse CD103 Antibody[M290]

Sign In for Pricing
View Details
Purified Anti-Mouse CD103 Antibody[M290]
E-AB-F1090A-02 100 µg

Purified Anti-Mouse CD103 Antibody[M290]

Sign In for Pricing
View Details