Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Cell migration-inducing and hyaluronan-binding protein (CEMIP), partial

Product Specifications

Product Name Alternative

Hyaluronan binding protein involved in hyaluronan depolymerization

Abbreviation

Recombinant Human CEMIP protein, partial

Gene Name

CEMIP

UniProt

Q8WUJ3

Expression Region

881-980aa

Organism

Homo sapiens (Human)

Target Sequence

YDGPINIQNCTFRKFVALEGRHTSALAFRLNNAWQSCPHNNVTGIAFEDVPITSRVFFGEPGPWFNQLDMDGDKTSVFHDVDGSVSEYPGSYLTKNDNWL

Tag

C-terminal 6xHis-tagged

Type

Developed Protein

Source

E.coli

Field of Research

Others

Relevance

Mediates depolymerization of hyaluronic acid (HA) via the cell membrane-associated clathrin-coated pit endocytic pathway. Binds to hyaluronic acid. Hydrolyzes high molecular weight hyaluronic acid to produce an intermediate-sized product, a process that may occur through rapid vesicle endocytosis and recycling without intracytoplasmic accumulation or digestion in lysosomes. Involved in hyaluronan catabolism in the dermis of the skin and arthritic synovium. Positively regulates epithelial-mesenchymal transition (EMT), and hence tumor cell growth, invasion and cancer dissemination. In collaboration with HSPA5/BIP, promotes cancer cell migration in a calcium and PKC-dependent manner. May be involved in hearing

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

18.2 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Partial

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ES8L3 antibody
70R-32025 100 ug

ES8L3 antibody

Sign In for Pricing
View Details
Timp1 sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 3)
K7029808 1.0 µg DNA

Timp1 sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 3)

Sign In for Pricing
View Details
LAP3 Polyclonal Antibody
orb618012-01 50 μL

LAP3 Polyclonal Antibody

Sign In for Pricing
View Details
LAP3 Polyclonal Antibody
orb618012-02 100 µL

LAP3 Polyclonal Antibody

Sign In for Pricing
View Details
Ethyl 2- (4-methoxyphenyl) thiazole-4-carboxylate
448769-01 100 mg

Ethyl 2- (4-methoxyphenyl) thiazole-4-carboxylate

Sign In for Pricing
View Details
Ethyl 2- (4-methoxyphenyl) thiazole-4-carboxylate
448769-02 250 mg

Ethyl 2- (4-methoxyphenyl) thiazole-4-carboxylate

Sign In for Pricing
View Details