Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Cell migration-inducing and hyaluronan-binding protein (CEMIP), partial

Product Specifications

Product Name Alternative

Hyaluronan binding protein involved in hyaluronan depolymerization

Abbreviation

Recombinant Human CEMIP protein, partial

Gene Name

CEMIP

UniProt

Q8WUJ3

Expression Region

881-980aa

Organism

Homo sapiens (Human)

Target Sequence

YDGPINIQNCTFRKFVALEGRHTSALAFRLNNAWQSCPHNNVTGIAFEDVPITSRVFFGEPGPWFNQLDMDGDKTSVFHDVDGSVSEYPGSYLTKNDNWL

Tag

C-terminal 6xHis-tagged

Type

Developed Protein

Source

E.coli

Field of Research

Others

Relevance

Mediates depolymerization of hyaluronic acid (HA) via the cell membrane-associated clathrin-coated pit endocytic pathway. Binds to hyaluronic acid. Hydrolyzes high molecular weight hyaluronic acid to produce an intermediate-sized product, a process that may occur through rapid vesicle endocytosis and recycling without intracytoplasmic accumulation or digestion in lysosomes. Involved in hyaluronan catabolism in the dermis of the skin and arthritic synovium. Positively regulates epithelial-mesenchymal transition (EMT), and hence tumor cell growth, invasion and cancer dissemination. In collaboration with HSPA5/BIP, promotes cancer cell migration in a calcium and PKC-dependent manner. May be involved in hearing

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

18.2 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Partial

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

THG1L Human shRNA Plasmid Kit (Locus ID 54974)
TR307068 1 Kit

THG1L Human shRNA Plasmid Kit (Locus ID 54974)

Sign In for Pricing
View Details
Uros-set siRNA/shRNA/RNAi Lentivector (Mouse)
49253094 4x 500 ng

Uros-set siRNA/shRNA/RNAi Lentivector (Mouse)

Sign In for Pricing
View Details
Zfp346 Protein Lysate (Mouse) with C-HA Tag
50926034 100 µg

Zfp346 Protein Lysate (Mouse) with C-HA Tag

Sign In for Pricing
View Details
CD19 Mouse Monoclonal Antibody (SJ25C1), CF®700 Conjugate - Biotium Choice
P010-700-500 1x 500 µL

CD19 Mouse Monoclonal Antibody (SJ25C1), CF®700 Conjugate - Biotium Choice

Sign In for Pricing
View Details
SAPK4 (MAPK13) (NM_002754) Human Over-expression Lysate
LS005603-20ug 20 µg

SAPK4 (MAPK13) (NM_002754) Human Over-expression Lysate

Sign In for Pricing
View Details
OAEF00979-1MG - Escherichia coli (E. coli) O157 Antibody
OAEF00979-1MG 1 mg

OAEF00979-1MG - Escherichia coli (E. coli) O157 Antibody

Sign In for Pricing
View Details