Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Pseudomonas phage PP7 Capsid protein

Product Specifications

Product Name Alternative

Coat protein

Abbreviation

Recombinant Pseudomonas phage PP7 Capsid protein

UniProt

P03630

Expression Region

2-127aa

Organism

Pseudomonas phage PP7 (Bacteriophage PP7)

Target Sequence

SKTIVLSVGEATRTLTEIQSTADRQIFEEKVGPLVGRLRLTASLRQNGAKTAYRVNLKLDQADVVDCSTSVCGELPKVRYTQVWSHDVTIVANSTEASRKSLYDLTKSLVATSQVEDLVVNLVPLG

Tag

C-terminal 6xHis-tagged

Type

Developed Protein

Source

E.coli

Field of Research

Others

Relevance

Capsid protein self-assembles to form an icosahedral capsid with a T=3 symmetry, about 26 nm in diameter, and consisting of 89 capsid proteins dimers (178 capsid proteins) . Involved in viral genome encapsidation through the interaction between a capsid protein dimer and the multiple packaging signals present in the RNA genome

Purity

Greater than 95% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

20.6 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Mature Protein

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Yipf2 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Mouse)
K3476205 3x 1.0 µg

Yipf2 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Mouse)

Sign In for Pricing
View Details
Mouse Chit1 ELISA kit
orb624335-01 48 Tests

Mouse Chit1 ELISA kit

Sign In for Pricing
View Details
Mouse Chit1 ELISA kit
orb624335-02 96 Tests

Mouse Chit1 ELISA kit

Sign In for Pricing
View Details
PDGFC Blocking Peptide
orb706225-01 1 mg

PDGFC Blocking Peptide

Sign In for Pricing
View Details
PDGFC Blocking Peptide
orb706225-02 5 mg

PDGFC Blocking Peptide

Sign In for Pricing
View Details
100 Replacement Ring Magnets for SSRL Cassette
M-CP-111-006-100 100 Magnets

100 Replacement Ring Magnets for SSRL Cassette

Sign In for Pricing
View Details