Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Streptococcus pneumoniae Surface protein pspA (pspA), Partial

Product Specifications

Product Name Alternative

PspA; spr0121

Abbreviation

Recombinant Streptococcus pneumoniae pspA protein, partial

Gene Name

PspA

UniProt

Q8DRI0

Expression Region

199-319aa

Organism

Streptococcus pneumoniae (strain ATCC BAA-255 / R6)

Target Sequence

DAEEVAPQAKIAELENQVHRLEQELKEIDESESEDYAKEGFRAPLQSKLDAKKAKLSKLEELSDKIDELDAEIAKLEDQLKAAEENNNVEDYFKEGLEKTIAAKKAELEKTEADLKKAVNE

Tag

C-terminal 6xHis-tagged

Type

Developed Protein

Source

E.coli

Field of Research

Others

Purity

Greater than 85% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

20.6 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Partial

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Slc25a35 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Mouse)
K4620505 3x 1.0 µg

Slc25a35 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Mouse)

Sign In for Pricing
View Details
Rabbit Insulin Like Growth Factor 1 Receptor (IGF1R) ELISA Kit-Sandwich
EK3F122-01 48 Test

Rabbit Insulin Like Growth Factor 1 Receptor (IGF1R) ELISA Kit-Sandwich

Sign In for Pricing
View Details
Rabbit Insulin Like Growth Factor 1 Receptor (IGF1R) ELISA Kit-Sandwich
EK3F122-02 96 Tests

Rabbit Insulin Like Growth Factor 1 Receptor (IGF1R) ELISA Kit-Sandwich

Sign In for Pricing
View Details
MFAP4 Polyclonal Antibody
A69591-100 100 µL

MFAP4 Polyclonal Antibody

Sign In for Pricing
View Details
NAA60 Polyclonal Antibody, Biotin Conjugated
A70274-050 50 μL

NAA60 Polyclonal Antibody, Biotin Conjugated

Sign In for Pricing
View Details
Lentiviral mouse Cdh5 shRNA (UAS) - Lentiviral mouse Cdh5 shRNA (UAS, RFP) plasmid
GTR15213109 1 Vial

Lentiviral mouse Cdh5 shRNA (UAS) - Lentiviral mouse Cdh5 shRNA (UAS, RFP) plasmid

Sign In for Pricing
View Details