Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Streptococcus pneumoniae Surface protein pspA (pspA), Partial

Product Specifications

Product Name Alternative

PspA; spr0121

Abbreviation

Recombinant Streptococcus pneumoniae pspA protein, partial

Gene Name

PspA

UniProt

Q8DRI0

Expression Region

199-319aa

Organism

Streptococcus pneumoniae (strain ATCC BAA-255 / R6)

Target Sequence

DAEEVAPQAKIAELENQVHRLEQELKEIDESESEDYAKEGFRAPLQSKLDAKKAKLSKLEELSDKIDELDAEIAKLEDQLKAAEENNNVEDYFKEGLEKTIAAKKAELEKTEADLKKAVNE

Tag

C-terminal 6xHis-tagged

Type

Developed Protein

Source

E.coli

Field of Research

Others

Purity

Greater than 85% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

20.6 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Partial

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CEACAM5 Rabbit Polyclonal Antibody
orb512576 100 µg

CEACAM5 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
RGD1561311 3'UTR Luciferase Stable Cell Line
TU218372 1.0 mL

RGD1561311 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
HLA Class II Histocompatibility Antigen, DR Alpha Chain (HLA-DRA) Antibody
abx405889-01 100 µL

HLA Class II Histocompatibility Antigen, DR Alpha Chain (HLA-DRA) Antibody

Sign In for Pricing
View Details
HLA Class II Histocompatibility Antigen, DR Alpha Chain (HLA-DRA) Antibody
abx405889-02 200 µL

HLA Class II Histocompatibility Antigen, DR Alpha Chain (HLA-DRA) Antibody

Sign In for Pricing
View Details
HLA Class II Histocompatibility Antigen, DR Alpha Chain (HLA-DRA) Antibody
abx405889-03 1 mL

HLA Class II Histocompatibility Antigen, DR Alpha Chain (HLA-DRA) Antibody

Sign In for Pricing
View Details
TRBV4-1 3'UTR Lenti-reporter-Luc Vector
47649081 1.0 µg

TRBV4-1 3'UTR Lenti-reporter-Luc Vector

Sign In for Pricing
View Details