Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Macaca mulatta TNF receptor superfamily member 13C (TNFRSF13C), partial

Product Specifications

Abbreviation

Recombinant Rhesus macaque TNFRSF13C protein, partial

Gene Name

TNFRSF13C

UniProt

A0A5F7ZFG6

Expression Region

7-76aa

Organism

Macaca mulatta (Rhesus macaque)

Target Sequence

SLRGRDAPAPTPCVPAECFDLLVRHCVACGLLRTPRPKPAPASSPAPRTALQPQESVGAGAGEAALSLPG

Tag

C-terminal 10xHis-tagged

Type

Developed Protein

Source

Mammalian cell

Field of Research

Others

Purity

Greater than 95% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

9.8 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Partial

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD11c (HC1/1), CF680R conjugate, 0.1mg/mL
BNC810152-500 1x 500 µL

CD11c (HC1/1), CF680R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD44 Standard (156-3C11), CF740 conjugate, 0.1mg/mL
BNC740460-500 1x 500 µL

CD44 Standard (156-3C11), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD95 (B-R18), CF740 conjugate, 0.1mg/mL
BNC740305-100 1x 100 µL

CD95 (B-R18), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
P21 / WAF1 (WA-1), CF647 conjugate, 0.1mg/mL
BNC470043-500 1x 500 µL

P21 / WAF1 (WA-1), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD3e (B-B12), CF647 conjugate, 0.1mg/mL
BNC471052-500 1x 500 µL

CD3e (B-B12), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD171 / L1CAM (L1 Cell Adhesion Molecule) (UJ127), CF640R conjugate, 0.1mg/mL
BNC400679-500 1x 500 µL

CD171 / L1CAM (L1 Cell Adhesion Molecule) (UJ127), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details