Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Dog tissue kallikrein (KLK5), partial

Product Specifications

Abbreviation

Recombinant Dog KLK5 protein, partial

Gene Name

KLK5

UniProt

A0A8C0M0S1

Expression Region

68-294aa

Organism

Canis lupus familiaris (Dog) (Canis familiaris)

Target Sequence

IVNGTDCEKNAQPWQGALLLGPNKLYCGAVLVNPQWLLTAAHCRKPFFRIRLGHHSLSPVYEAGQQLFKGIKSIPHPGYSHPGHSNDLMLIKLNRKIRETQRVKPINISSKCPSAGTSCMVSGWGTTNSPNVQFPKVLQCLNITVLSDDRCRKAYPRQIDSTMFCAGDEAGRDSCQGDSGGPVVCNGSLQGLVSWGDFPCAQPNRPGVYTNLCQFTKWIKDTIQSNS

Tag

C-terminal 10xHis-tagged

Type

Developed Protein

Source

Mammalian cell

Field of Research

Others

Purity

Greater than 95% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

27.6 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Partial

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD1a (O10 + C1A/711), CF405S conjugate, 0.1mg/mL
BNC040717-500 1x 500 µL

CD1a (O10 + C1A/711), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
4930504O13Rik (NM_207527) Mouse Tagged ORF Clone
MG200960 10 µg

4930504O13Rik (NM_207527) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
Tropomodulin 2 (TMOD2) Rabbit Monoclonal Antibody
TA424180 100 µL

Tropomodulin 2 (TMOD2) Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
Amplite® Colorimetric Peroxidase (HRP) Assay Kit *Blue Color*
11551-AAT 500 Tests

Amplite® Colorimetric Peroxidase (HRP) Assay Kit *Blue Color*

Sign In for Pricing
View Details
Acetaldehyde 2,4-Dinitrophenylhydrazone-d3
TRC-A132702-5MG 5 mg

Acetaldehyde 2,4-Dinitrophenylhydrazone-d3

Sign In for Pricing
View Details
Tissue FFPE Sections, Breast
CS710592 5x 5 µm

Tissue FFPE Sections, Breast

Sign In for Pricing
View Details