Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse T-cell surface glycoprotein CD8 alpha chain (Cd8a), partial

Product Specifications

Product Name Alternative

T-cell surface glycoprotein Lyt-2

Abbreviation

Recombinant Mouse Cd8a protein, partial

Gene Name

Cd8a

UniProt

P01731

Expression Region

28-196aa

Organism

Mus musculus (Mouse)

Target Sequence

KPQAPELRIFPKKMDAELGQKVDLVCEVLGSVSQGCSWLFQNSSSKLPQPTFVVYMASSHNKITWDEKLNSSKLFSAMRDTNNKYVLTLNKFSKENEGYYFCSVISNSVMYFSSVVPVLQKVNSTTTKPVLRTPSPVHPTGTSQPQRPEDCRPRGSVKGTGLDFACDIY

Tag

C-terminal 10xHis-tagged

Type

Developed Protein

Source

Mammalian cell

Field of Research

Immunology

Relevance

Integral membrane glycoprotein that plays an essential role in the immune response and serves multiple functions in responses against both external and internal offenses. In T-cells, functions primarily as a coreceptor for MHC class I molecule:peptide complex. The antigens presented by class I peptides are derived from cytosolic proteins while class II derived from extracellular proteins. Interacts simultaneously with the T-cell receptor (TCR) and the MHC class I proteins presented by antigen presenting cells (APCs) . In turn, recruits the Src kinase LCK to the vicinity of the TCR-CD3 complex. LCK then initiates different intracellular signaling pathways by phosphorylating various substrates ultimately leading to lymphokine production, motility, adhesion and activation of cytotoxic T-lymphocytes (CTLs) . This mechanism enables CTLs to recognize and eliminate infected cells and tumor cells. In NK-cells, the presence of CD8A homodimers at the cell surface provides a survival mechanism allowing conjugation and lysis of multiple target cells. CD8A homodimer molecules also promote the survival and differentiation of activated lymphocytes into memory CD8 T-cells

Purity

Greater than 95% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

20.3 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Partial

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TCF3 Antibody, Biotin conjugated
MBS7049251-01 0.05 mg

TCF3 Antibody, Biotin conjugated

Sign In for Pricing
View Details
TCF3 Antibody, Biotin conjugated
MBS7049251-02 0.1 mg

TCF3 Antibody, Biotin conjugated

Sign In for Pricing
View Details
TCF3 Antibody, Biotin conjugated
MBS7049251-03 5x 0.1 mg

TCF3 Antibody, Biotin conjugated

Sign In for Pricing
View Details
Human SRP72 qPCR Primer Pair
QH23309S 200 Tests

Human SRP72 qPCR Primer Pair

Sign In for Pricing
View Details
USE1, NT (USE1, USE1L, Vesicle transport protein USE1, Putative MAPK-activating protein PM26, USE1-like protein, p31) (AP) discontinued
043649-AP 200 µL

USE1, NT (USE1, USE1L, Vesicle transport protein USE1, Putative MAPK-activating protein PM26, USE1-like protein, p31) (AP) discontinued

Sign In for Pricing
View Details
SLC2A9 siRNA (Human)
MBS8215407-01 15 nmol

SLC2A9 siRNA (Human)

Sign In for Pricing
View Details