Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Natural cytotoxicity triggering receptor 1 (Ncr1), partial

Product Specifications

Product Name Alternative

Activating receptor 1; Lymphocyte antigen 94; Natural killer cell p46-related protein

Abbreviation

Recombinant Mouse Ncr1 protein, partial

Gene Name

Ncr1

UniProt

Q8C567

Expression Region

17-255aa

Organism

Mus musculus (Mouse)

Target Sequence

QRINTEKETLPKPIIWAKPSIMVTNGNSVNIWCQGAQSASEYQLYFEGSFFALERPKPSRSMNKVRFFISQMTSHTAGIYTCFYQSGELWSKSSNPLKLVVTGLYDTPNLWVYPRPEVTLGENVTFFCQLKTATSKFFLLKERGSNHIQNKYGNIQAEFPMGPVTRAHRGTYRCFGSYNDYAWSFPSEPVTLLITGGVENSSLAPTDPTSSLDYWEFDLSTNESGLQKDSAFWDHTTQN

Tag

C-terminal 10xHis-tagged

Type

Developed Protein

Source

Mammalian cell

Field of Research

Cancer

Relevance

Cytotoxicity-activating receptor that may contribute to the increased efficiency of activated natural killer (NK) cells to mediate tumor cell lysis

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

28.5 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Partial

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SRD5A2L2 (TECRL) Human Gene Knockout Kit (CRISPR)
KN419868 1 Kit

SRD5A2L2 (TECRL) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Frozen Tissue Blocks, Liver
CB518561 1 Block

Frozen Tissue Blocks, Liver

Sign In for Pricing
View Details
Mouse Fzd8 activation kit by CRISPRa
GA201499 1 Kit

Mouse Fzd8 activation kit by CRISPRa

Sign In for Pricing
View Details
BECN1 Polyclonal Antibody
AN006940L-01 25 µL

BECN1 Polyclonal Antibody

Sign In for Pricing
View Details
BECN1 Polyclonal Antibody
AN006940L-02 100 µL

BECN1 Polyclonal Antibody

Sign In for Pricing
View Details
XFD610 acid
70060-AAT 10 mg

XFD610 acid

Sign In for Pricing
View Details