Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Stromal cell-derived factor 1 (Cxcl12)

Product Specifications

Product Name Alternative

12-O-tetradecanoylphorbol 13-acetate repressed protein 1; C-X-C motif chemokine 12; Pre-B cell growth-stimulating factor; Thymic lymphoma cell-stimulating factor

Abbreviation

Recombinant Mouse Cxcl12 protein

Gene Name

Cxcl12

UniProt

P40224

Expression Region

22-93aa

Organism

Mus musculus (Mouse)

Target Sequence

KPVSLSYRCPCRFFESHIARANVKHLKILNTPNCALQIVARLKNNNRQVCIDPKLKWIQEYLEKALNKRLKM

Tag

N-terminal hFc1-tagged

Type

Developed Protein

Source

Mammalian cell

Field of Research

Others

Relevance

Chemoattractant active on T-lymphocytes and monocytes but not neutrophils. Activates the C-X-C chemokine receptor CXCR4 to induce a rapid and transient rise in the level of intracellular calcium ions and chemotaxis. Also binds to atypical chemokine receptor ACKR3, which activates the beta-arrestin pathway and acts as a scavenger receptor for CXCL12/SDF-1. Binds to the allosteric site (site 2) of integrins and activates integrins ITGAV:ITGB3, ITGA4:ITGB1 and ITGA5:ITGB1 in a CXCR4-independent manner. Acts as a positive regulator of monocyte migration and a negative regulator of monocyte adhesion via the LYN kinase. Stimulates migration of monocytes and T-lymphocytes through its receptors, CXCR4 and ACKR3, and decreases monocyte adherence to surfaces coated with ICAM-1, a ligand for beta-2 integrins. CXCR4 signaling axis inhibits beta-2 integrin LFA-1 mediated adhesion of monocytes to ICAM-1 through LYN kinase. Plays a protective role after myocardial infarction. Induces down-regulation and internalization of ACKR3 expressed in various cells. Has several critical functions during embryonic development; required for B-cell lymphopoiesis, myelopoiesis in bone marrow and heart ventricular septum formation. Stimulates the proliferation of bone marrow-derived B-cell progenitors in the presence of IL7 as well as growth of stromal cell-dependent pre-B-cells

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

34.6 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Mature Protein

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Sheep Alpha- (1, 3) -fucosyltransferase (FUT5) ELISA Kit
MBS7223690-01 48 Well

Sheep Alpha- (1, 3) -fucosyltransferase (FUT5) ELISA Kit

Sign In for Pricing
View Details
Sheep Alpha- (1, 3) -fucosyltransferase (FUT5) ELISA Kit
MBS7223690-02 96 Well

Sheep Alpha- (1, 3) -fucosyltransferase (FUT5) ELISA Kit

Sign In for Pricing
View Details
Sheep Alpha- (1, 3) -fucosyltransferase (FUT5) ELISA Kit
MBS7223690-03 5x 96 Well

Sheep Alpha- (1, 3) -fucosyltransferase (FUT5) ELISA Kit

Sign In for Pricing
View Details
Sheep Alpha- (1, 3) -fucosyltransferase (FUT5) ELISA Kit
MBS7223690-04 10x 96 Well

Sheep Alpha- (1, 3) -fucosyltransferase (FUT5) ELISA Kit

Sign In for Pricing
View Details
[5- (2-Chloro-phenyl) -[1,3,4]oxadiazol-2-ylsulfanyl]-acetic acid
sc-356944A 1 g

[5- (2-Chloro-phenyl) -[1,3,4]oxadiazol-2-ylsulfanyl]-acetic acid

Sign In for Pricing
View Details
Recombinant Saccharomyces cerevisiae AP-3 complex subunit mu (APM3)
MBS1153062-01 0.02 mg (E-Coli)

Recombinant Saccharomyces cerevisiae AP-3 complex subunit mu (APM3)

Sign In for Pricing
View Details