Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 5 (NDUFA5)

Product Specifications

Product Name Alternative

Complex I subunit B13; Complex I-13kD-B; NADH-ubiquinone oxidoreductase 13 kDa-B subunit

Abbreviation

Recombinant Human NDUFA5 protein

Gene Name

NDUFA5

UniProt

Q16718

Expression Region

2-116aa

Organism

Homo sapiens (Human)

Target Sequence

AGVLKKTTGLVGLAVCNTPHERLRILYTKILDVLEEIPKNAAYRKYTEQITNEKLAMVKAEPDVKKLEDQLQGGQLEEVILQAEHELNLARKMREWKLWEPLVEEPPADQWKWPI

Tag

N-terminal 6xHis-tagged

Type

Developed Protein

Source

Mammalian cell

Field of Research

Cancer

Relevance

Accessory subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I), that is believed not to be involved in catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

15.5 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MTHFD2 (MTHFD2L) (NM_001144978) Human Over-expression Lysate
LC428620 20 µg

MTHFD2 (MTHFD2L) (NM_001144978) Human Over-expression Lysate

Sign In for Pricing
View Details
Human PEX5 related protein (PEX5L) activation kit by CRISPRa
GA109871 1 Kit

Human PEX5 related protein (PEX5L) activation kit by CRISPRa

Sign In for Pricing
View Details
MUC1 / CA15-3 / EMA / CD227 (Epithelial Marker) (MUC1/2278R), Biotin conjugate, 0.1mg/mL
BNCB2278-500 1x 500 µL

MUC1 / CA15-3 / EMA / CD227 (Epithelial Marker) (MUC1/2278R), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Rpia (Center) Rabbit Polyclonal Antibody
AP46163PU-N 100 µL

Rpia (Center) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
PODNL1 (NM_001146255) Human Over-expression Lysate
LC431364 20 µg

PODNL1 (NM_001146255) Human Over-expression Lysate

Sign In for Pricing
View Details
Allyl Cyanide
TRC-A549770-5G 5 g

Allyl Cyanide

Sign In for Pricing
View Details