Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Serum amyloid A-2 protein (Saa2)

Product Specifications

Product Name Alternative

Saa2

Abbreviation

Recombinant Mouse Saa2 protein

Gene Name

Saa2

UniProt

P05367

Expression Region

20-122aa

Organism

Mus musculus (Mouse)

Target Sequence

GFFSFIGEAFQGAGDMWRAYTDMKEAGWKDGDKYFHARGNYDAAQRGPGGVWAAEKISDARESFQEFFGRGHEDTMADQEANRHGRSGKDPNYYRPPGLPAKY

Tag

N-terminal 6xHis-tagged

Type

Developed Protein

Source

Mammalian cell

Field of Research

Others

Relevance

Major acute phase reactant

Purity

Greater than 95% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

13.7 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

FANCA Antibody, HRP conjugated
A21595-50UG 50 µg

FANCA Antibody, HRP conjugated

Sign In for Pricing
View Details
ADCYAP1R1 Antibody
31286 100 µL

ADCYAP1R1 Antibody

Sign In for Pricing
View Details
Biotinylated Anti-SARS-CoV-2 RBD antibody (DM27) ; Rabbit mAb
12-9018B-100 100 µg

Biotinylated Anti-SARS-CoV-2 RBD antibody (DM27) ; Rabbit mAb

Sign In for Pricing
View Details
C11orf83 Protein Lysate (Human) with C-Ha Tag
13721031 100 µg

C11orf83 Protein Lysate (Human) with C-Ha Tag

Sign In for Pricing
View Details
Rat Capza2 ELISA Kit
ELI-10890r 96 Tests

Rat Capza2 ELISA Kit

Sign In for Pricing
View Details
PAK2, NT (p21 Activated Kinase 2, p21-activated Kinase 2, p21(CDKN1A)-activated Kinase 2, PAK-2, Gamma PAK, hPAK65, p58, p65-PAK, PAK65, PAKgamma, S6/H4 Kinase, Serine/threonine Protein Kinase PAK 2) (MaxLight 550)
MBS6491830-01 0.1 mL

PAK2, NT (p21 Activated Kinase 2, p21-activated Kinase 2, p21(CDKN1A)-activated Kinase 2, PAK-2, Gamma PAK, hPAK65, p58, p65-PAK, PAK65, PAKgamma, S6/H4 Kinase, Serine/threonine Protein Kinase PAK 2) (MaxLight 550)

Sign In for Pricing
View Details