Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Serum amyloid A-2 protein (Saa2)

Product Specifications

Product Name Alternative

Saa2

Abbreviation

Recombinant Mouse Saa2 protein

Gene Name

Saa2

UniProt

P05367

Expression Region

20-122aa

Organism

Mus musculus (Mouse)

Target Sequence

GFFSFIGEAFQGAGDMWRAYTDMKEAGWKDGDKYFHARGNYDAAQRGPGGVWAAEKISDARESFQEFFGRGHEDTMADQEANRHGRSGKDPNYYRPPGLPAKY

Tag

N-terminal 6xHis-tagged

Type

Developed Protein

Source

Mammalian cell

Field of Research

Others

Relevance

Major acute phase reactant

Purity

Greater than 95% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

13.7 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human Leukocyte Ig-Like Receptor B2/LILRB2/ILT4/CD85d (C-6His)
AP75187-01 10 µg

Recombinant Human Leukocyte Ig-Like Receptor B2/LILRB2/ILT4/CD85d (C-6His)

Sign In for Pricing
View Details
Recombinant Human Leukocyte Ig-Like Receptor B2/LILRB2/ILT4/CD85d (C-6His)
AP75187-02 50 µg

Recombinant Human Leukocyte Ig-Like Receptor B2/LILRB2/ILT4/CD85d (C-6His)

Sign In for Pricing
View Details
Recombinant Human Leukocyte Ig-Like Receptor B2/LILRB2/ILT4/CD85d (C-6His)
AP75187-03 500 µg

Recombinant Human Leukocyte Ig-Like Receptor B2/LILRB2/ILT4/CD85d (C-6His)

Sign In for Pricing
View Details
Recombinant Human Leukocyte Ig-Like Receptor B2/LILRB2/ILT4/CD85d (C-6His)
AP75187-04 1 mg

Recombinant Human Leukocyte Ig-Like Receptor B2/LILRB2/ILT4/CD85d (C-6His)

Sign In for Pricing
View Details
HSPB7 Rabbit Polyclonal Antibody (APC-Cy5.5)
orb2376465 100 µL

HSPB7 Rabbit Polyclonal Antibody (APC-Cy5.5)

Sign In for Pricing
View Details
Folic acid
CMS175-5G 1 unit

Folic acid

Sign In for Pricing
View Details