Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Clostridium pasteurianum Rubredoxin

Product Specifications

Product Name Alternative

Rd

Abbreviation

Recombinant Clostridium pasteurianum Rubredoxin protein

UniProt

P00268

Expression Region

1-54aa

Organism

Clostridium pasteurianum

Target Sequence

MKKYTCTVCGYIYNPEDGDPDNGVNPGTDFKDIPDDWVCPLCGVGKDQFEEVEE

Tag

N-terminal GST-tagged

Type

Developed Protein

Source

Yeast

Field of Research

Others

Relevance

Rubredoxin is a small nonheme, iron protein lacking acid-labile sulfide. Its single Fe, chelated to 4 Cys, functions as an electron acceptor and may also stabilize the conformation of the molecule

Purity

Greater than 95% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

32.2 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Bovine Glucose-6-phosphate isomerase, GPI ELISA Kit
MBS1602430-01 48 Well

Bovine Glucose-6-phosphate isomerase, GPI ELISA Kit

Sign In for Pricing
View Details
Bovine Glucose-6-phosphate isomerase, GPI ELISA Kit
MBS1602430-02 96 Well

Bovine Glucose-6-phosphate isomerase, GPI ELISA Kit

Sign In for Pricing
View Details
Bovine Glucose-6-phosphate isomerase, GPI ELISA Kit
MBS1602430-03 5x 96 Well

Bovine Glucose-6-phosphate isomerase, GPI ELISA Kit

Sign In for Pricing
View Details
Bovine Glucose-6-phosphate isomerase, GPI ELISA Kit
MBS1602430-04 10x 96 Well

Bovine Glucose-6-phosphate isomerase, GPI ELISA Kit

Sign In for Pricing
View Details
CHCHD6 (NM_032343) Human Recombinant Protein
PROTQ9BRQ6 20 µg

CHCHD6 (NM_032343) Human Recombinant Protein

Sign In for Pricing
View Details
Rabbit Anti-Mouse IgM
orb869151-01 1 mg

Rabbit Anti-Mouse IgM

Sign In for Pricing
View Details