Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mycobacterium tuberculosis Co-chaperonin GroES (groES)

Product Specifications

Product Name Alternative

10 kDa chaperonin; Chaperonin-10

Abbreviation

Recombinant Mycobacterium tuberculosis groES protein

Gene Name

GroES

UniProt

A5U893

Expression Region

1-100aa

Organism

Mycobacterium tuberculosis (strain ATCC 25177 / H37Ra)

Target Sequence

MAKVNIKPLEDKILVQANEAETTTASGLVIPDTAKEKPQEGTVVAVGPGRWDEDGEKRIPLDVAEGDTVIYSKYGGTEIKYNGEEYLILSARDVLAVVSK

Tag

C-terminal 6xHis-tagged

Type

Developed Protein

Source

Yeast

Field of Research

Others

Relevance

Together with the chaperonin GroEL, plays an essential role in assisting protein folding. The GroEL-GroES system forms a nano-cage that allows encapsulation of the non-native substrate proteins and provides a physical environment optimized to promote and accelerate protein folding. GroES binds to the apical surface of the GroEL ring, thereby capping the opening of the GroEL channel

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

12.3 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GATA3 (NM_002051) Human Over-expression Lysate
LC400759 20 µg

GATA3 (NM_002051) Human Over-expression Lysate

Sign In for Pricing
View Details
Mouse Eftud2 activation kit by CRISPRa
GA204008 1 Kit

Mouse Eftud2 activation kit by CRISPRa

Sign In for Pricing
View Details
CD45RB (PTPRC/1132), CF568 conjugate, 0.1mg/mL
BNC681132-500 1x 500 µL

CD45RB (PTPRC/1132), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
2-(6-oxopiperidin-2-yl)acetic acid
TRC-O991308-5MG 5 mg

2-(6-oxopiperidin-2-yl)acetic acid

Sign In for Pricing
View Details
(2,5-Dioxopyrrolidin-1-yl)acetic acid
TRC-B593303-50MG 50 mg

(2,5-Dioxopyrrolidin-1-yl)acetic acid

Sign In for Pricing
View Details
alpha 1 Glycine Receptor (GLRA1) (NM_000171) Human Over-expression Lysate
LY400062 100 µg

alpha 1 Glycine Receptor (GLRA1) (NM_000171) Human Over-expression Lysate

Sign In for Pricing
View Details