Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Emericella nidulans Rodlet protein (rodA)

Product Specifications

Product Name Alternative

Rodlet protein A

Abbreviation

Recombinant Emericella nidulans rodA protein

Gene Name

RodA

UniProt

P28346

Expression Region

42-157aa

Organism

Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) (Aspergillus nidulans)

Target Sequence

FPVPENVTVKQASDKCGDQAQLSCCNKATYAGDTTTVDEGLLSGALSGLIGAGSGAEGLGLFDQCSKLDVAVLIGIQDLVNQKCKQNIACCQNSPSSADGNLIGVGLPCVALGSIL

Tag

N-terminal 6xHis-sumostar-tagged

Type

Developed Protein

Source

Yeast

Field of Research

Others

Relevance

Aerial growth, conidiation, and dispersal of filamentous fungi in the environment rely upon a capability of their secreting small amphipathic proteins called hydrophobins (HPBs) with low sequence identity. Class I can self-assemble into an outermost layer of rodlet bundles on aerial cell surfaces, conferring cellular hydrophobicity that supports fungal growth, development and dispersal; whereas Class II form highly ordered films at water-air interfaces through intermolecular interactions but contribute nothing to the rodlet structure (Probable) . RodA is a class I hydrophobin that contributes to surface hydrophobicity, which is important for processes such as association of hyphae in reproductive structures, dispersal of aerial spores and adhesion of pathogens to host structures. Important for the formation of hydrophobic rodlet layers of asexually-produced spores. Promotes also biofilm formation and may enhance lignocellulose utilization via promoting a compact substrate-enzyme-fungus structure

Purity

Greater than 85% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

24.7 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Mature Protein

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD20 (B9E9), CF568 conjugate, 0.1mg/mL
BNC680160-500 1x 500 µL

CD20 (B9E9), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD43 (84-3C1), CF405S conjugate, 0.1mg/mL
BNC040342-500 1x 500 µL

CD43 (84-3C1), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD45RO (UCHL-1), CF488A conjugate, 0.1mg/mL
BNC880003-100 1x 100 µL

CD45RO (UCHL-1), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD171 / L1CAM (L1 Cell Adhesion Molecule) (UJ127), CF647 conjugate, 0.1mg/mL
BNC470679-100 1x 100 µL

CD171 / L1CAM (L1 Cell Adhesion Molecule) (UJ127), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
UACA / Nucling (AE-5), CF568 conjugate, 0.1mg/mL
BNC680956-500 1x 500 µL

UACA / Nucling (AE-5), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Histone H1 (HH1/957), CF488A conjugate, 0.1mg/mL
BNC880957-500 1x 500 µL

Histone H1 (HH1/957), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details