Recombinant Emericella nidulans Rodlet protein (rodA)
Product Specifications
Product Name Alternative
Rodlet protein A
Abbreviation
Recombinant Emericella nidulans rodA protein
Gene Name
RodA
UniProt
P28346
Expression Region
42-157aa
Organism
Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) (Aspergillus nidulans)
Target Sequence
FPVPENVTVKQASDKCGDQAQLSCCNKATYAGDTTTVDEGLLSGALSGLIGAGSGAEGLGLFDQCSKLDVAVLIGIQDLVNQKCKQNIACCQNSPSSADGNLIGVGLPCVALGSIL
Tag
N-terminal 6xHis-sumostar-tagged
Type
Developed Protein
Source
Yeast
Field of Research
Others
Relevance
Aerial growth, conidiation, and dispersal of filamentous fungi in the environment rely upon a capability of their secreting small amphipathic proteins called hydrophobins (HPBs) with low sequence identity. Class I can self-assemble into an outermost layer of rodlet bundles on aerial cell surfaces, conferring cellular hydrophobicity that supports fungal growth, development and dispersal; whereas Class II form highly ordered films at water-air interfaces through intermolecular interactions but contribute nothing to the rodlet structure (Probable) . RodA is a class I hydrophobin that contributes to surface hydrophobicity, which is important for processes such as association of hyphae in reproductive structures, dispersal of aerial spores and adhesion of pathogens to host structures. Important for the formation of hydrophobic rodlet layers of asexually-produced spores. Promotes also biofilm formation and may enhance lignocellulose utilization via promoting a compact substrate-enzyme-fungus structure
Purity
Greater than 85% as determined by SDS-PAGE.
Activity
Not Test
Form
Liquid or Lyophilized powder
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Molecular Weight
24.7 kDa
Storage Conditions
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Protein Length
Full Length of Mature Protein
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog