Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Macaca fascicularis Interleukin-21 receptor (IL21R), partial (Active)

Product Specifications

Product Name Alternative

Interleukin-21 receptor; Novel interleukin receptor

Abbreviation

Recombinant Cynomolgus monkey IL21R protein, partial (Active)

Gene Name

IL21R

UniProt

G7Q0S8

Expression Region

41-253aa

Organism

Macaca fascicularis (Crab-eating macaque) (Cynomolgus monkey)

Target Sequence

CPDLVCYTDYLQTVICILEMWNLHPSTLTLTWQDQYEELKDEATSCSLHRSAHNATHATYTCHMDVFHFMADDIFSVNVTDHSGNYTQECGSFLLADSIKPAPPFNVTVTFSGQYNISWRSDYEDPAFYMLKGKLQYELQYRNRGDPWAVSPRRKLISVDSRSVSLLPLEFRKDSSYELQVRAGPMPGSSYQGTWSEWSDPVIFQTQSEELKE

Tag

C-terminal 10xHis-tagged

Type

Active Protein & In Stock Protein

Source

Mammalian cell

Field of Research

Cancer

Relevance

This is a receptor for interleukin-21. {ECO:0000256|ARBA:ARBA00057584}.

Endotoxin

Less than 1.0 EU/μg as determined by LAL method.

Purity

Greater than 95% as determined by SDS-PAGE.

Activity

Yes

Bioactivity

1Measured by its binding ability in a functional ELISA. Immobilized Macaca fascicularis IL21R at 2 μg/mL can bind Human IL21 (CSB-MP872537HU) . The EC50 is 15.01-19.43 ng/mL. 2Human IL21 (CSB-MP872537HU) captured on Protein A Chip can bind Recombinant Macaca fascicularis IL21R with an affinity constant of 1.31 nM as detected by MetaSPR Assay (WeSPRTM 200) .

Form

Lyophilized powder

Buffer

Lyophilized from a 0.2 μm sterile filtered PBS, 6% Trehalose, pH 7.4

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

26.2 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Partial

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Von Willebrand Factor / Factor VIII Related-Ag (Endothelial Marker) (rVWF/1465), CF640R conjugate, 0.1mg/mL
BNC401540-500 1x 500 µL

Von Willebrand Factor / Factor VIII Related-Ag (Endothelial Marker) (rVWF/1465), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Prothrombin (F2) (NM_000506) Human Over-expression Lysate
LC400182 20 µg

Prothrombin (F2) (NM_000506) Human Over-expression Lysate

Sign In for Pricing
View Details
Mouse 1700008O03Rik activation kit by CRISPRa
GA208141 1 Kit

Mouse 1700008O03Rik activation kit by CRISPRa

Sign In for Pricing
View Details
DNMT1 Human Gene Knockout Kit (CRISPR)
KN217851 1 Kit

DNMT1 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
CDC42 binding protein kinase alpha (CDC42BPA) Mouse Monoclonal Antibody [Clone ID: OTI7B9]
CF808223 100 µg

CDC42 binding protein kinase alpha (CDC42BPA) Mouse Monoclonal Antibody [Clone ID: OTI7B9]

Sign In for Pricing
View Details
Human IFIT2 activation kit by CRISPRa
GA102323 1 Kit

Human IFIT2 activation kit by CRISPRa

Sign In for Pricing
View Details