Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Arginase-1 (ARG1) (Active)

Product Specifications

Product Name Alternative

Arginase-1; EC 3.5.3.1; Liver-type arginase; Type I arginase

Abbreviation

Recombinant Human ARG1 protein (Active)

Gene Name

ARG1

UniProt

P05089

Expression Region

1-322aa

Organism

Homo sapiens (Human)

Target Sequence

MSAKSRTIGIIGAPFSKGQPRGGVEEGPTVLRKAGLLEKLKEQECDVKDYGDLPFADIPNDSPFQIVKNPRSVGKASEQLAGKVAEVKKNGRISLVLGGDHSLAIGSISGHARVHPDLGVIWVDAHTDINTPLTTTSGNLHGQPVSFLLKELKGKIPDVPGFSWVTPCISAKDIVYIGLRDVDPGEHYILKTLGIKYFSMTEVDRLGIGKVMEETLSYLLGRKKRPIHLSFDVDGLDPSFTPATGTPVVGGLTYREGLYITEEIYKTGLLSGLDIMEVNPSLGKTPEEVTRTVNTAVAITLACFGLAREGNHKPIDYLNPPK

Tag

C-terminal 10xHis-tagged

Type

Active Protein & In Stock Protein

Source

Mammalian cell

Field of Research

Cancer

Relevance

Key element of the urea cycle converting L-arginine to urea and L-ornithine, which is further metabolized into metabolites proline and polyamides that drive collagen synthesis and bioenergetic pathways critical for cell proliferation, respectively; the urea cycle takes place primarily in the liver and, to a lesser extent, in the kidneys.Curated Functions in L-arginine homeostasis in nonhepatic tissues characterized by the competition between nitric oxide synthase (NOS) and arginase for the available intracellular substrate arginine. Arginine metabolism is a critical regulator of innate and adaptive immune responses. Involved in an antimicrobial effector pathway in polymorphonuclear granulocytes (PMN) . Upon PMN cell death is liberated from the phagolysosome and depletes arginine in the microenvironment leading to suppressed T cell and natural killer (NK) cell proliferation and cytokine secretion (PubMed:15546957, PubMed:16709924, PubMed:19380772) . In group 2 innate lymphoid cells (ILC2s) promotes acute type 2 inflammation in the lung and is involved in optimal ILC2 proliferation but not survival (By similarity) . In humans, the immunological role in the monocytic/macrophage/dendritic cell (DC) lineage is unsure.

Endotoxin

Less than 1.0 EU/μg as determined by LAL method.

Purity

Greater than 95% as determined by SDS-PAGE.

Activity

Yes

Bioactivity

1Measured by its binding ability in a functional ELISA. Immobilized Human ARG1 at 2 μg/mL can bind Anti-ARG1 recombinant antibody (CSB-RA002005MA1HU) . The EC50 is 2.291-3.018 ng/mL. 2ARG1 Recombinant Monoclonal Antibody (CSB-RA002005MA1HU) captured on Protein A Chip can bind Recombinant Human ARG1 with an affinity constant of 0.918 nM as detected by MetaSPR Assay (WeSPRTM 200) .

Form

Lyophilized powder

Buffer

Lyophilized from a 0.2 μm sterile filtered PBS, 6% Trehalose, pH 7.4

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

36.2 kDa

References & Citations

The DNA sequence and analysis of human chromosome 6. Mungall A.J., Palmer S.A., Sims S.K., Edwards C.A., Ashurst J.L., Wilming L., Jones M.C., Horton R., Hunt S.E., Beck S. Nature 425:805-811 (2003)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SMG1 Human Gene Knockout Kit (CRISPR)
KN424277 1 Kit

SMG1 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
SCRN1 (NM_014766) Human Recombinant Protein
TP306268M 100 µg

SCRN1 (NM_014766) Human Recombinant Protein

Sign In for Pricing
View Details
Iodosobenzene
TRC-I737195-500MG 500 mg

Iodosobenzene

Sign In for Pricing
View Details
Human IgM (Immunoglobulin Mu Heavy Chain) (B-Cell Marker) (IGHM/2557R), CF647 conjugate, 0.1mg/mL
BNC472557-100 1x 100 µL

Human IgM (Immunoglobulin Mu Heavy Chain) (B-Cell Marker) (IGHM/2557R), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Smooth Muscle Actin (1A4), CF405S conjugate, 0.1mg/mL
BNC040665-100 1x 100 µL

Smooth Muscle Actin (1A4), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
HER-2 / CD340 (HRB2/451), CF488A conjugate, 0.1mg/mL
BNC880451-100 1x 100 µL

HER-2 / CD340 (HRB2/451), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details