What is the catalog number for Recombinant Rat Tonin (Klk2)?

The catalog number for Recombinant Rat Tonin (Klk2) is CSB-MP012453RAd9.

What sizes are available for Recombinant Rat Tonin (Klk2)?

Recombinant Rat Tonin (Klk2) is available in the following size(s): 20 µg, 100 µg, 1 mg.

How many pack sizes does Recombinant Rat Tonin (Klk2) come in?

Recombinant Rat Tonin (Klk2) is available in 3 different pack sizes.

Is Recombinant Rat Tonin (Klk2) in stock?

Recombinant Rat Tonin (Klk2) is currently made to order / not held in immediate stock. Contact us for lead time.

Who manufactures Recombinant Rat Tonin (Klk2)?

Recombinant Rat Tonin (Klk2) is manufactured by Cusabio.

What is the estimated delivery time for Recombinant Rat Tonin (Klk2)?

Estimated delivery time for Recombinant Rat Tonin (Klk2) is approximately 15 business day(s), depending on your location.

Where can I find the safety data sheet (SDS/MSDS) for Recombinant Rat Tonin (Klk2)?

The safety data sheet for Recombinant Rat Tonin (Klk2) is available here: https://www.cusabio.com/msds/12949538/.

Recombinant Rat Tonin (Klk2)

Product Specifications

Product Name Alternative

Esterase 1; Glandular kallikrein-2; RSKG-5; S2 kallikrein

Abbreviation

Recombinant Rat Klk2 protein

Gene Name

Klk2

UniProt

P00759

Expression Region

25-259aa

Organism

Rattus norvegicus (Rat)

Target Sequence

IVGGYKCEKNSQPWQVAVINEYLCGGVLIDPSWVITAAHCYSNNYQVLLGRNNLFKDEPFAQRRLVRQSFRHPDYIPLIVTNDTEQPVHDHSNDLMLLHLSEPADITGGVKVIDLPTKEPKVGSTCLASGWGSTNPSEMVVSHDLQCVNIHLLSNEKCIETYKDNVTDVMLCAGEMEGGKDTCAGDSGGPLICDGVLQGITSGGATPCAKPKTPAIYAKLIKFTSWIKKVMKENP

Tag

C-terminal hFc1-tagged

Type

Developed Protein

Source

Mammalian cell

Field of Research

Cancer

Relevance

This protein has both trypsin- and chymotrypsin-like activities, being able to release angiotensin II from angiotensin I or angiotensinogen

Purity

Greater than 95% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.265.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

54.5 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.