Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rat Tonin (Klk2)

Product Specifications

Product Name Alternative

Esterase 1; Glandular kallikrein-2; RSKG-5; S2 kallikrein

Abbreviation

Recombinant Rat Klk2 protein

Gene Name

Klk2

UniProt

P00759

Expression Region

25-259aa

Organism

Rattus norvegicus (Rat)

Target Sequence

IVGGYKCEKNSQPWQVAVINEYLCGGVLIDPSWVITAAHCYSNNYQVLLGRNNLFKDEPFAQRRLVRQSFRHPDYIPLIVTNDTEQPVHDHSNDLMLLHLSEPADITGGVKVIDLPTKEPKVGSTCLASGWGSTNPSEMVVSHDLQCVNIHLLSNEKCIETYKDNVTDVMLCAGEMEGGKDTCAGDSGGPLICDGVLQGITSGGATPCAKPKTPAIYAKLIKFTSWIKKVMKENP

Tag

C-terminal hFc1-tagged

Type

Developed Protein

Source

Mammalian cell

Field of Research

Cancer

Relevance

This protein has both trypsin- and chymotrypsin-like activities, being able to release angiotensin II from angiotensin I or angiotensinogen

Purity

Greater than 95% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.265.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

54.5 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Mature Protein

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PGR Antibody
orb570751-01 50 µg

PGR Antibody

Sign In for Pricing
View Details
PGR Antibody
orb570751-02 100 µg

PGR Antibody

Sign In for Pricing
View Details
TMEM173 discontinued
543185-01 30ul

TMEM173 discontinued

Sign In for Pricing
View Details
TMEM173 discontinued
543185-02 100 µL

TMEM173 discontinued

Sign In for Pricing
View Details
Rabbit Polyclonal RUSC2 Antibody [DyLight 405]
NBP2-81786V 0.1 mL

Rabbit Polyclonal RUSC2 Antibody [DyLight 405]

Sign In for Pricing
View Details
Lactate Dehydrogenase, pan (LDH, Malaria) (MaxLight 750) discontinued
227050-ML750 100 µL

Lactate Dehydrogenase, pan (LDH, Malaria) (MaxLight 750) discontinued

Sign In for Pricing
View Details