Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Dog Haptoglobin (HP)

Product Specifications

Abbreviation

Recombinant Dog HP protein

Gene Name

HP

UniProt

P19006

Expression Region

1-329aa

Organism

Canis lupus familiaris (Dog) (Canis familiaris)

Target Sequence

EDTGSEATNNTEVSLPKPPVIENGYVEHMIRYQCKPFYKLHTEGDGVYTLNSEKHWTNKAVGEKLPECEAVCGKPKNPVDQVQRIMGGSVDAKGSFPWQAKMVSHHNLTSGATLINEQWLLTTAKNLFLGHKDDAKANDIAPTLKLYVGKNQLVEVEKVVLHPDYSKVDIGLIKLKQKVPIDERVMPICLPSKDYAEVGRIGYVSGWGRNSNFNFTELLKYVMLPVADQDKCVQHYEGSTVPEKKSPKSPVGVQPILNEHTFCAGMSKFQEDTCYGDAGSAFAVHDQDEDTWYAAGILSFDKSCTVAEYGVYVKVPSVLAWVQETIAGN

Tag

C-terminal 6xHis-tagged

Type

Developed Protein

Source

E.coli

Field of Research

Others

Relevance

As a result of hemolysis, hemoglobin is found to accumulate in the kidney and is secreted in the urine. Haptoglobin captures, and combines with free plasma hemoglobin to allow hepatic recycling of heme iron and to prevent kidney damage. Haptoglobin also acts as an antioxidant, has antibacterial activity and plays a role in modulating many aspects of the acute phase response. Hemoglobin/haptoglobin complexes are rapidly cleared by the macrophage CD163 scavenger receptor expressed on the surface of liver Kupfer cells through an endocytic lysosomal degradation pathway

Purity

Greater than 85% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.261.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

43.4 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PRR18, CT (PRR18, Proline-rich protein 18) (FITC)
MBS6337735-01 0.2 mL

PRR18, CT (PRR18, Proline-rich protein 18) (FITC)

Sign In for Pricing
View Details
PRR18, CT (PRR18, Proline-rich protein 18) (FITC)
MBS6337735-02 5x 0.2 mL

PRR18, CT (PRR18, Proline-rich protein 18) (FITC)

Sign In for Pricing
View Details
Recombinant Vibrio cholerae serotype O1 Sulfate/thiosulfate import ATP-binding protein CysA (cysA)
MBS1343563-01 0.02 mg (E-Coli)

Recombinant Vibrio cholerae serotype O1 Sulfate/thiosulfate import ATP-binding protein CysA (cysA)

Sign In for Pricing
View Details
Recombinant Vibrio cholerae serotype O1 Sulfate/thiosulfate import ATP-binding protein CysA (cysA)
MBS1343563-02 0.02 mg (Yeast)

Recombinant Vibrio cholerae serotype O1 Sulfate/thiosulfate import ATP-binding protein CysA (cysA)

Sign In for Pricing
View Details
Recombinant Vibrio cholerae serotype O1 Sulfate/thiosulfate import ATP-binding protein CysA (cysA)
MBS1343563-03 0.1 mg (E-Coli)

Recombinant Vibrio cholerae serotype O1 Sulfate/thiosulfate import ATP-binding protein CysA (cysA)

Sign In for Pricing
View Details
Recombinant Vibrio cholerae serotype O1 Sulfate/thiosulfate import ATP-binding protein CysA (cysA)
MBS1343563-04 0.1 mg (Yeast)

Recombinant Vibrio cholerae serotype O1 Sulfate/thiosulfate import ATP-binding protein CysA (cysA)

Sign In for Pricing
View Details