Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Aldehyde oxidase (AOX1), partial

Product Specifications

Product Name Alternative

Aldehyde oxidase 1; Azaheterocycle hydroxylase

Abbreviation

Recombinant Human AOX1 protein, partial

Gene Name

AOX1

UniProt

Q06278

Expression Region

236-421aa

Organism

Homo sapiens (Human)

Target Sequence

FGSERMMWFSPVTLKELLEFKFKYPQAPVIMGNTSVGPEVKFKGVFHPVIISPDRIEELSVVNHAYNGLTLGAGLSLAQVKDILADVVQKLPEEKTQMYHALLKHLGTLAGSQIRNMASLGGHIISRHPDSDLNPILAVGNCTLNLLSKEGKRQIPLNEQFLSKCPNADLKPQEILVSVNIPYSRK

Tag

C-terminal 6xHis-tagged

Type

Developed Protein

Source

E.coli

Field of Research

Metabolism

Relevance

Oxidase with broad substrate specificity, oxidizing aromatic azaheterocycles, such as N1-methylnicotinamide, N-methylphthalazinium and phthalazine, as well as aldehydes, such as benzaldehyde, retinal, pyridoxal, and vanillin. Plays a key role in the metabolism of xenobiotics and drugs containing aromatic azaheterocyclic substituents. Participates in the bioactivation of prodrugs such as famciclovir, catalyzing the oxidation step from 6-deoxypenciclovir to penciclovir, which is a potent antiviral agent. Is probably involved in the regulation of reactive oxygen species homeostasis. May be a prominent source of superoxide generation via the one-electron reduction of molecular oxygen. May also catalyze nitric oxide (NO) production via the reduction of nitrite to NO with NADH or aldehyde as electron donor. May play a role in adipogenesis

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.251.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

27.5 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Partial

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human HTRA4 siRNA
abx902590-01 15 nmol

Human HTRA4 siRNA

Sign In for Pricing
View Details
Human HTRA4 siRNA
abx902590-02 30 nmol

Human HTRA4 siRNA

Sign In for Pricing
View Details
Human IGF1R Protein, His Tag
E40KMPH1285 20 µg

Human IGF1R Protein, His Tag

Sign In for Pricing
View Details
Slc2a1 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Rat)
44090116 3x 1.0 µg

Slc2a1 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Rat)

Sign In for Pricing
View Details
Recombinant Moloney murine sarcoma virus GTPase HRas (H-RAS)
MBS1066527-01 0.02 mg (E-Coli)

Recombinant Moloney murine sarcoma virus GTPase HRas (H-RAS)

Sign In for Pricing
View Details
Recombinant Moloney murine sarcoma virus GTPase HRas (H-RAS)
MBS1066527-02 0.1 mg (E-Coli)

Recombinant Moloney murine sarcoma virus GTPase HRas (H-RAS)

Sign In for Pricing
View Details