Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rat Natriuretic peptides B (Nppb), partial

Product Specifications

Product Name Alternative

Brain natriuretic factor prohormone; Gamma-brain natriuretic peptide; Iso-ANP

Abbreviation

Recombinant Rat Nppb protein, partial

Gene Name

Nppb

UniProt

P13205

Expression Region

27-102aa

Organism

Rattus norvegicus (Rat)

Target Sequence

HPLGSPSQSPEQSTMQKLLELIREKSEEMAQRQLSKDQGPTKELLKRVLRSQDSAFRIQERLRNSKMAHSSSCFGQ

Tag

C-terminal 6xHis-tagged

Type

Developed Protein

Source

E.coli

Field of Research

Cardiovascular

Relevance

Cardiac hormone that plays a key role in mediating cardio-renal homeostasis. May also function as a paracrine antifibrotic factor in the heart. Acts by specifically binding and stimulating NPR1 to produce cGMP, which in turn activates effector proteins that drive various biological responses. Likely involved in regulating the extracellular fluid volume and maintaining the fluid-electrolyte balance through natriuresis, diuresis, kaluresis and chloruresis

Purity

Greater than 95% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.248.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

15.6 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Partial

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human SPOP knockout cell line
ABC-KH14601 1 Vial

Human SPOP knockout cell line

Sign In for Pricing
View Details
Camel Sodium Channel Protein Type 8 Subunit Alpha (SCN8A) ELISA Kit
MBS9917571-01 48 Well

Camel Sodium Channel Protein Type 8 Subunit Alpha (SCN8A) ELISA Kit

Sign In for Pricing
View Details
Camel Sodium Channel Protein Type 8 Subunit Alpha (SCN8A) ELISA Kit
MBS9917571-02 96 Well

Camel Sodium Channel Protein Type 8 Subunit Alpha (SCN8A) ELISA Kit

Sign In for Pricing
View Details
Camel Sodium Channel Protein Type 8 Subunit Alpha (SCN8A) ELISA Kit
MBS9917571-03 5x 96 Well

Camel Sodium Channel Protein Type 8 Subunit Alpha (SCN8A) ELISA Kit

Sign In for Pricing
View Details
Camel Sodium Channel Protein Type 8 Subunit Alpha (SCN8A) ELISA Kit
MBS9917571-04 10x 96 Well

Camel Sodium Channel Protein Type 8 Subunit Alpha (SCN8A) ELISA Kit

Sign In for Pricing
View Details
Sheep Lymphotoxin beta ELISA Kit
MBS009094-01 48 Well

Sheep Lymphotoxin beta ELISA Kit

Sign In for Pricing
View Details