Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Transcription factor E2-alpha (TCF3), partial

Product Specifications

Product Name Alternative

Class B basic helix-loop-helix protein 21; Immunoglobulin enhancer-binding factor E12/E47; Immunoglobulin transcription factor 1; Kappa-E2-binding factor; Transcription factor 3; Transcription factor ITF-1

Abbreviation

Recombinant Human TCF3 protein, partial

Gene Name

TCF3

UniProt

P15923-2

Expression Region

535-613aa

Organism

Homo sapiens (Human)

Target Sequence

LSLEEKDLRDRERRMANNARERVRVRDINEAFRELGRMCQMHLKSDKAQTKLLILQQAVQVILGLEQQVRERNLNPKAA

Tag

N-terminal GST-tagged and C-terminal 6xHis-tagged

Type

Developed Protein

Source

E.coli

Field of Research

Immunology

Relevance

Facilitates ATOH7 binding to DNA at the consensus sequence 5'-CAGGTG-3', and positively regulates transcriptional activity

Purity

Greater than 95% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.243.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

37.6 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Partial of Isoform E47

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD73 (Immuno-Oncology Target) (NT5E/2646), CF640R conjugate, 0.1mg/mL
BNC402646-100 1x 100 µL

CD73 (Immuno-Oncology Target) (NT5E/2646), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
STAT 5A+B Recombinant Rabbit monoclonal Antibody
HA750310 100 µL

STAT 5A+B Recombinant Rabbit monoclonal Antibody

Sign In for Pricing
View Details
Imidaclothiz
TRC-I275000-250MG 250 mg

Imidaclothiz

Sign In for Pricing
View Details
Drebrin (DBN1) (1-326) Mouse Monoclonal Antibody [Clone ID: DBN-N-03]
AP32304RP-N 100 Tests

Drebrin (DBN1) (1-326) Mouse Monoclonal Antibody [Clone ID: DBN-N-03]

Sign In for Pricing
View Details
Human CD73 Recombinant Rabbit Monoclonal Antibody [PSH08-15] - BSA and Azide free (Capture)
HA722957 100 µL

Human CD73 Recombinant Rabbit Monoclonal Antibody [PSH08-15] - BSA and Azide free (Capture)

Sign In for Pricing
View Details
Tcf25 Mouse Gene Knockout Kit (CRISPR)
KN517324 1 Kit

Tcf25 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details