Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Glycoprotein hormones alpha chain (Cga)

Product Specifications

Product Name Alternative

Anterior pituitary glycoprotein hormones common subunit alpha; Follicle-stimulating hormone alpha chain; Follitropin alpha chain; Luteinizing hormone alpha chain; Lutropin alpha chain; Thyroid-stimulating hormone alpha chain; Thyrotropin alpha chain

Abbreviation

Recombinant Mouse Cga protein

Gene Name

Cga

UniProt

P01216

Expression Region

25-120aa

Organism

Mus musculus (Mouse)

Target Sequence

LPDGDFIIQGCPECKLKENKYFSKLGAPIYQCMGCCFSRAYPTPARSKKTMLVPKNITSEATCCVAKAFTKATVMGNARVENHTECHCSTCYYHKS

Tag

C-terminal 6xHis-tagged

Type

Developed Protein

Source

E.coli

Field of Research

Signal Transduction

Relevance

Shared alpha chain of the active heterodimeric glycoprotein hormones thyrotropin/thyroid stimulating hormone/TSH, lutropin/luteinizing hormone/LH and follitropin/follicle stimulating hormone/FSH. These hormones bind specific receptors on target cells that in turn activate downstream signaling pathways

Purity

Greater than 85% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.242.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

17.6 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Mature Protein

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-MRP-S34 antibody
STJ94253 200 µl

Anti-MRP-S34 antibody

Sign In for Pricing
View Details
RPS6P23 Protein Lysate (Human) with C-Ha Tag
42618031 100 µg

RPS6P23 Protein Lysate (Human) with C-Ha Tag

Sign In for Pricing
View Details
Gm6807 Mouse siRNA Oligo Duplex (Locus ID 627889)
SR408538 1 Kit

Gm6807 Mouse siRNA Oligo Duplex (Locus ID 627889)

Sign In for Pricing
View Details
2-Bromo-4,5-difluorobenzeneboronic acid
PC56674-01 1 g

2-Bromo-4,5-difluorobenzeneboronic acid

Sign In for Pricing
View Details
2-Bromo-4,5-difluorobenzeneboronic acid
PC56674-02 5 g

2-Bromo-4,5-difluorobenzeneboronic acid

Sign In for Pricing
View Details
GENLISA™ Human KeRatin, type II cytoskeletal 1 (KRT1) ELISA
KBH3645 96 Well

GENLISA™ Human KeRatin, type II cytoskeletal 1 (KRT1) ELISA

Sign In for Pricing
View Details