Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Glycoprotein hormones alpha chain (Cga)

Product Specifications

Product Name Alternative

Anterior pituitary glycoprotein hormones common subunit alpha; Follicle-stimulating hormone alpha chain; Follitropin alpha chain; Luteinizing hormone alpha chain; Lutropin alpha chain; Thyroid-stimulating hormone alpha chain; Thyrotropin alpha chain

Abbreviation

Recombinant Mouse Cga protein

Gene Name

Cga

UniProt

P01216

Expression Region

25-120aa

Organism

Mus musculus (Mouse)

Target Sequence

LPDGDFIIQGCPECKLKENKYFSKLGAPIYQCMGCCFSRAYPTPARSKKTMLVPKNITSEATCCVAKAFTKATVMGNARVENHTECHCSTCYYHKS

Tag

C-terminal 6xHis-tagged

Type

Developed Protein

Source

E.coli

Field of Research

Signal Transduction

Relevance

Shared alpha chain of the active heterodimeric glycoprotein hormones thyrotropin/thyroid stimulating hormone/TSH, lutropin/luteinizing hormone/LH and follitropin/follicle stimulating hormone/FSH. These hormones bind specific receptors on target cells that in turn activate downstream signaling pathways

Purity

Greater than 85% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.242.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

17.6 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Mature Protein

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

WNT3 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)
K2641805 3x 1.0 µg

WNT3 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)

Sign In for Pricing
View Details
Human SGSM2 Pre-designed siRNA Set A
SI014675A 1 Each

Human SGSM2 Pre-designed siRNA Set A

Sign In for Pricing
View Details
OKRC00615-96W - IL-2 R alpha ELISA Kit (Human)
OKRC00615-96W 96 Well

OKRC00615-96W - IL-2 R alpha ELISA Kit (Human)

Sign In for Pricing
View Details
Lentiviral human NGLY1 shRNA (UAS) - Lentiviral human NGLY1 shRNA (UAS, iRFP) (25)
GTR15342161 1 Vial

Lentiviral human NGLY1 shRNA (UAS) - Lentiviral human NGLY1 shRNA (UAS, iRFP) (25)

Sign In for Pricing
View Details
Diisobutyl Phosphite
447044-01 1 g

Diisobutyl Phosphite

Sign In for Pricing
View Details
Diisobutyl Phosphite
447044-02 5 g

Diisobutyl Phosphite

Sign In for Pricing
View Details