Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Ly6/PLAUR domain-containing protein 1 (LYPD1)

Product Specifications

Product Name Alternative

Putative HeLa tumor suppressor

Abbreviation

Recombinant Human LYPD1 protein

Gene Name

LYPD1

UniProt

Q8N2G4

Expression Region

21-117aa

Organism

Homo sapiens (Human)

Target Sequence

LQIQCYQCEEFQLNNDCSSPEFIVNCTVNVQDMCQKEVMEQSAGIMYRKSCASSAACLIASAGYQSFCSPGKLNSVCISCCNTPLCNGPRPKKRGSS

Tag

C-terminal 6xHis-tagged

Type

Developed Protein

Source

E.coli

Field of Research

Cancer

Relevance

Believed to act as a modulator of nicotinic acetylcholine receptors (nAChRs) activity. In vitro increases receptor desensitization and decreases affinity for ACh of alpha-4:beta-2-containing nAChRs. May play a role in the intracellular trafficking of alpha-4:beta-2 and alpha-7-containing nAChRs and may inhibit their expression at the cell surface. May be involved in the control of anxiety

Purity

Greater than 95% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.227.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

17.5 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Mature Protein

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human neurite outgrowth inhibitor A (NOGO-A) ELISA Kit
EIA07340h 1 Kit

Human neurite outgrowth inhibitor A (NOGO-A) ELISA Kit

Sign In for Pricing
View Details
ADR2 rabbit pAb Antibody
orb2306213-01 50 µL

ADR2 rabbit pAb Antibody

Sign In for Pricing
View Details
ADR2 rabbit pAb Antibody
orb2306213-02 100 µL

ADR2 rabbit pAb Antibody

Sign In for Pricing
View Details
SYNPR (NM_144642) Human Tagged ORF Clone Lentiviral Particle
RC205424L4V 200 µL

SYNPR (NM_144642) Human Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
Cdc6 Rat shRNA Plasmid (Locus ID 360621)
TR706836 1 Kit

Cdc6 Rat shRNA Plasmid (Locus ID 360621)

Sign In for Pricing
View Details
Guinea pig Pyridoxamine-5'-Phosphate Oxidase (PNPO) ELISA Kit
MBS2614691-01 48 Well

Guinea pig Pyridoxamine-5'-Phosphate Oxidase (PNPO) ELISA Kit

Sign In for Pricing
View Details