Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Saccharomyces cerevisiae Lipid-anchored plasma membrane protein CPP1 (CPP1)

Product Specifications

Product Name Alternative

C-terminally palmitoylated protein CPP1; Cysteine-rich protein CPP1

Abbreviation

Recombinant Saccharomyces cerevisiae CPP1 protein

Gene Name

CPP1

UniProt

P38216

Expression Region

2-128aa

Organism

Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast)

Target Sequence

SANDYYGGTAGEKSQYSRPSNPPPSSAHQNKTQERGYPPQQQQQYYQQQQQHPGYYNQQGYNQQGYNQQGYNQQGYNQQGYNQQGYNQQGHQQPVYVQQQPPQRGNEGCLAACLAALCICCTMDMLF

Tag

C-terminal 6xHis-tagged

Type

Developed Protein

Source

E.coli

Field of Research

Others

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.226.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

21.4 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Mature Protein

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Bovine Transmembrane protein 206, TMEM206 ELISA Kit
MBS9326669-01 48 Well

Bovine Transmembrane protein 206, TMEM206 ELISA Kit

Sign In for Pricing
View Details
Bovine Transmembrane protein 206, TMEM206 ELISA Kit
MBS9326669-02 96 Well

Bovine Transmembrane protein 206, TMEM206 ELISA Kit

Sign In for Pricing
View Details
Bovine Transmembrane protein 206, TMEM206 ELISA Kit
MBS9326669-03 5x 96 Well

Bovine Transmembrane protein 206, TMEM206 ELISA Kit

Sign In for Pricing
View Details
Bovine Transmembrane protein 206, TMEM206 ELISA Kit
MBS9326669-04 10x 96 Well

Bovine Transmembrane protein 206, TMEM206 ELISA Kit

Sign In for Pricing
View Details
Indobufen Impurity 18
RM-I041544-01 10 mg

Indobufen Impurity 18

Sign In for Pricing
View Details
Indobufen Impurity 18
RM-I041544-02 25 mg

Indobufen Impurity 18

Sign In for Pricing
View Details