Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rat Interleukin-7 (Il7)

Product Specifications

Abbreviation

Recombinant Rat Il7 protein

Gene Name

Il7

UniProt

P56478

Expression Region

26-154aa

Organism

Rattus norvegicus (Rat)

Target Sequence

DCHIKDKDGKAFGSVLMISINQLDKMTGTDSDCPNNEPNFFKKHLCDDTKEAAFLNRAARKLRQFLKMNISEEFNDHLLRVSDGTQTLVNCTSKEEKTIKEQKKNDPCFLKRLLREIKTCWNKILKGSI

Tag

C-terminal 6xHis-tagged

Type

Developed Protein

Source

E.coli

Field of Research

Immunology

Relevance

Hematopoietic cytokine that plays an essential role in the development, expansion, and survival of naive and memory T-cells and B-cells thereby regulating the number of mature lymphocytes and maintaining lymphoid homeostasis. Mechanistically, exerts its biological effects through a receptor composed of IL7RA subunit and the cytokine receptor common subunit gamma/CSF2RG. Binding to the receptor leads to activation of various kinases including JAK1 or JAK3 depending on the cell type and subsequently propagation of signals through activation of several downstream signaling pathways including the PI3K/Akt/mTOR or the JAK-STAT5

Purity

Greater than 85% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.208.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

21.8 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Mature Protein

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Pim-1 (Ab-309) Antibody
8B0712-AAT 50 µg

Pim-1 (Ab-309) Antibody

Sign In for Pricing
View Details
MAP7D2 (NM_001168467) Human Over-expression Lysate
LC433420 20 µg

MAP7D2 (NM_001168467) Human Over-expression Lysate

Sign In for Pricing
View Details
Coro7 Mouse Gene Knockout Kit (CRISPR)
KN503708 1 Kit

Coro7 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Macrophage Scavenger Receptor I (MSR1) (NM_002445) Human Over-expression Lysate
LC419319 20 µg

Macrophage Scavenger Receptor I (MSR1) (NM_002445) Human Over-expression Lysate

Sign In for Pricing
View Details
Frozen Tissue Sections, Cervix
CS519534 5x 5 µm

Frozen Tissue Sections, Cervix

Sign In for Pricing
View Details
SSH2 (NM_001282130) Human Tagged ORF Clone
RG236478 10 µg

SSH2 (NM_001282130) Human Tagged ORF Clone

Sign In for Pricing
View Details