Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rotavirus A Outer capsid glycoprotein VP7

Product Specifications

Abbreviation

Recombinant Rotavirus A Outer capsid glycoprotein VP7 protein

UniProt

B3SRX9

Expression Region

51-326aa

Organism

Rotavirus A (isolate RVA/Human/United States/WI61/1983/G9P1A[8]) (RV-A)

Target Sequence

QNYGINLPITGSMDTAYANSSQLDTFLTSTLCLYYPAEASTQIGDTEWKNTLSQLFLTKGWPTGSVYFKEYTDIASFSIDPQLYCDYNVVLMKYDSTLKLDMSELADLILNEWLCNPMDITLYYYQQTDEANKWIAMGQSCTIKVCPLNTQTLGIGCTTTNTATFEEVAASEKLVITDVVDGVNHKLDVTTTTCTIRNCRKLGPRENVAIIQVGGSEVLDITADPTTAPQTERMMRINWKKWWQVFYTVVDYINQIVQVMSKRSRSLNSAAFYYRV

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Type

Developed Protein

Source

E.coli

Field of Research

Others

Relevance

Calcium-binding protein that interacts with rotavirus cell receptors once the initial attachment by VP4 has been achieved. Rotavirus attachment and entry into the host cell probably involves multiple sequential contacts between the outer capsid proteins VP4 and VP7, and the cell receptors. Following entry into the host cell, low intracellular or intravesicular Ca (2+) concentration probably causes the calcium-stabilized VP7 trimers to dissociate from the virion. This step is probably necessary for the membrane-disrupting entry step and the release of VP4, which is locked onto the virion by VP7

Purity

Greater than 95% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.196.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

38.7 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Mature Protein

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GSTM3 siRNA Oligos set (Human)
22756171 3x 5 nmol

GSTM3 siRNA Oligos set (Human)

Sign In for Pricing
View Details
WDR33 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV)
50321061 1.0 µg DNA

WDR33 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV)

Sign In for Pricing
View Details
Calcr (NM_001034015) Rat Tagged ORF Clone Lentiviral Particle
RR200229L4V 200 µL

Calcr (NM_001034015) Rat Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
Multiplex Assay Kit for Hepatocyte Growth Factor Activator (HGFAC), etc. by FLIA (Flow Luminescence Immunoassay)
TRV-0031353 96 Tests

Multiplex Assay Kit for Hepatocyte Growth Factor Activator (HGFAC), etc. by FLIA (Flow Luminescence Immunoassay)

Sign In for Pricing
View Details
Rhag sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 1)
K3992106 1.0 µg DNA

Rhag sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 1)

Sign In for Pricing
View Details
Monkey Alstrom syndrome protein 1 (ALMS1) ELISA kit
GTR10407166 96 Well

Monkey Alstrom syndrome protein 1 (ALMS1) ELISA kit

Sign In for Pricing
View Details