Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Nuclear pore complex protein Nup153 (NUP153), partial

Product Specifications

Product Name Alternative

153 kDa nucleoporin; Nucleoporin Nup153

Abbreviation

Recombinant Human NUP153 protein, partial

Gene Name

NUP153

UniProt

P49790

Expression Region

657-880aa

Organism

Homo sapiens (Human)

Target Sequence

KAGSSWQCDTCLLQNKVTDNKCIACQAAKLSPRDTAKQTGIETPNKSGKTTLSASGTGFGDKFKPVIGTWDCDTCLVQNKPEAIKCVACETPKPGTCVKRALTLTVVSESAETMTASSSSCTVTTGTLGFGDKFKRPIGSWECSVCCVSNNAEDNKCVSCMSEKPGSSVPASSSSTVPVSLPSGGSLGLEKFKKPEGSWDCELCLVQNKADSTKCLACESAKPG

Tag

C-terminal 6xHis-tagged

Type

Developed Protein

Source

E.coli

Field of Research

Immunology

Relevance

Component of the nuclear pore complex (NPC), a complex required for the trafficking across the nuclear envelope. Functions as a scaffolding element in the nuclear phase of the NPC essential for normal nucleocytoplasmic transport of proteins and mRNAs. Involved in the quality control and retention of unspliced mRNAs in the nucleus; in association with TPR, regulates the nuclear export of unspliced mRNA species bearing constitutive transport element (CTE) in a NXF1- and KHDRBS1-independent manner. Mediates TPR anchoring to the nuclear membrane at NPC. The repeat-containing domain may be involved in anchoring other components of the NPC to the pore membrane. Possible DNA-binding subunit of the nuclear pore complex (NPC)

Purity

Greater than 85% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.192.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

30.2 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Partial

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Monoclonal CD9 Antibody (SN4) [DyLight 350]
NBP1-43444UV 0.1 mL

Mouse Monoclonal CD9 Antibody (SN4) [DyLight 350]

Sign In for Pricing
View Details
NBLA00301 ORF Vector (Human) (pORF)
ORF013856 1.0 µg DNA

NBLA00301 ORF Vector (Human) (pORF)

Sign In for Pricing
View Details
Human GAL Antibody
E55A13983 100 µg

Human GAL Antibody

Sign In for Pricing
View Details
Magic™ Membrane Protein Human SLC25A4 (Solute carrier family 25 member 4) Expressed in vitro E.coli expression system, Full Length of Mature Protein
MPX2685K Each

Magic™ Membrane Protein Human SLC25A4 (Solute carrier family 25 member 4) Expressed in vitro E.coli expression system, Full Length of Mature Protein

Sign In for Pricing
View Details
Rabbit anti-Pol Lambda Antibody, Affinity Purified
MBS3902109-01 0.01 mg

Rabbit anti-Pol Lambda Antibody, Affinity Purified

Sign In for Pricing
View Details
Rabbit anti-Pol Lambda Antibody, Affinity Purified
MBS3902109-02 0.1 mg

Rabbit anti-Pol Lambda Antibody, Affinity Purified

Sign In for Pricing
View Details