Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Chicken Vitamin D3 receptor (VDR)

Product Specifications

Product Name Alternative

1,25-dihydroxyvitamin D3 receptor; Nuclear receptor subfamily 1 group I member 1

Abbreviation

Recombinant Chicken VDR protein

Gene Name

VDR

UniProt

O42392

Expression Region

1-451aa

Organism

Gallus gallus (Chicken)

Target Sequence

MSELRGSWDEQQQSMAYLPDADMDTVAASTSLPDPAGDFDRNVPRICGVCGDRATGFHFNAMTCEGCKGFFRRSMKRKAMFTCPFNGDCKITKDNRRHCQACRLKRCVDIGMMKEFILTDEEVQRKREMILKRKEEEALKESLKPKLSEEQQKVIDTLLEAHHKTFDTTYSDFNKFRPPVRSKFSSRMATHSSSVVSQDFSSEDSNDVFGSDAFAAFPEPMEPQMFSNLDLSEESDESPSMNIELPHLPMLPHLADLVSYSIQKVIGFAKMIPGFRDLTAEDQIALLKSSAIEVIMLRSNQSFTMEDMSWTCGSNDFKYKVSDVTQAGHSMDLLEPLVKFQVGLKKLNLHEEEHVLLMAICILSPDRPGVQDTSLVESIQDRLSDILQTYIRCRHPPPGSRLLYAKMIQKLADLRSLNEEHSKQYRCLSFQPEHSMQLTPLVLEVFGNEIS

Tag

C-terminal 6xHis-tagged

Type

Developed Protein

Source

E.coli

Field of Research

Others

Relevance

Nuclear receptor for calcitriol, the active form of vitamin D3 which mediates the action of this vitamin on cells. Enters the nucleus upon vitamin D3 binding where it forms heterodimers with the retinoid X receptor/RXR. The VDR-RXR heterodimers bind to specific response elements on DNA and activate the transcription of vitamin D3-responsive target genes. Plays a central role in calcium homeostasis. Also functions as a receptor for the secondary bile acid lithocholic acid (LCA) and its metabolites

Purity

Greater than 85% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.176.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

58.2 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Mediator of RNA polymerase II transcription subunit 1 (MED1) ELISA Kit
KTE61673-01 48 Tests

Human Mediator of RNA polymerase II transcription subunit 1 (MED1) ELISA Kit

Sign In for Pricing
View Details
Human Mediator of RNA polymerase II transcription subunit 1 (MED1) ELISA Kit
KTE61673-02 96 Tests

Human Mediator of RNA polymerase II transcription subunit 1 (MED1) ELISA Kit

Sign In for Pricing
View Details
Human Mediator of RNA polymerase II transcription subunit 1 (MED1) ELISA Kit
KTE61673-03 5x 96 Tests

Human Mediator of RNA polymerase II transcription subunit 1 (MED1) ELISA Kit

Sign In for Pricing
View Details
Human Mediator of RNA polymerase II transcription subunit 1 (MED1) ELISA Kit
KTE61673-04 50x 96 Tests

Human Mediator of RNA polymerase II transcription subunit 1 (MED1) ELISA Kit

Sign In for Pricing
View Details
RB12B rabbit pAb Antibody
orb2304104-01 50 µL

RB12B rabbit pAb Antibody

Sign In for Pricing
View Details
RB12B rabbit pAb Antibody
orb2304104-02 100 µL

RB12B rabbit pAb Antibody

Sign In for Pricing
View Details