Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human LIM domain kinase 2 (LIMK2), partial

Product Specifications

Abbreviation

Recombinant Human LIMK2 protein, partial

Gene Name

LIMK2

UniProt

P53671-3

Expression Region

347-659aa

Organism

Homo sapiens (Human)

Target Sequence

ETQKTFLTEVKVMRSLDHPNVLKFIGVLYKDKKLNLLTEYIEGGTLKDFLRSMDPFPWQQKVRFAKGIASGMAYLHSMCIIHRDLNSHNCLIKLDKTVVVADFGLSRLIVEERKRAPMEKATTKKRTLRKNDRKKRYTVVGNPYWMAPEMLNGKSYDETVDIFSFGIVLCEIIGQVYADPDCLPRTLDFGLNVKLFWEKFVPTDCPPAFFPLAAICCRLEPESRAPPGAAGEGPGCADDEGPVRRQGKVTIKYDPKELRKHLNLEEWILEQLTRLYDCQEEEISELEIDVDELLDMESDDAWASRVKELLVDC

Tag

N-terminal HSA-tagged and C-terminal 10xHis-tagged

Type

Developed Protein

Source

Mammalian cell

Field of Research

Cancer

Purity

Greater than 95% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.168.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

103.7 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Partial of Isoform 3

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mini Sample Mouse REN (Renin) ELISA Kit
E-MSEL-M0035-01 24 Tests

Mini Sample Mouse REN (Renin) ELISA Kit

Sign In for Pricing
View Details
Mini Sample Mouse REN (Renin) ELISA Kit
E-MSEL-M0035-02 48 Tests

Mini Sample Mouse REN (Renin) ELISA Kit

Sign In for Pricing
View Details
Mini Sample Mouse REN (Renin) ELISA Kit
E-MSEL-M0035-03 96 Tests

Mini Sample Mouse REN (Renin) ELISA Kit

Sign In for Pricing
View Details
PE/Elab Fluor® 594 Anti-Human CD195/CCR5 Antibody[HEK/1/85a]
E-AB-F1392P-01 20 Tests

PE/Elab Fluor® 594 Anti-Human CD195/CCR5 Antibody[HEK/1/85a]

Sign In for Pricing
View Details
PE/Elab Fluor® 594 Anti-Human CD195/CCR5 Antibody[HEK/1/85a]
E-AB-F1392P-02 100 Tests

PE/Elab Fluor® 594 Anti-Human CD195/CCR5 Antibody[HEK/1/85a]

Sign In for Pricing
View Details
PE/Elab Fluor® 594 Anti-Human CD195/CCR5 Antibody[HEK/1/85a]
E-AB-F1392P-03 2x 100 Tests

PE/Elab Fluor® 594 Anti-Human CD195/CCR5 Antibody[HEK/1/85a]

Sign In for Pricing
View Details