Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Adenosine receptor A2a (ADORA2A) -Detergent

Product Specifications

Abbreviation

Recombinant Human ADORA2A protein-Detergent

Gene Name

ADORA2A

UniProt

P29274

Expression Region

1-412aa

Organism

Homo sapiens (Human)

Target Sequence

MPIMGSSVYITVELAIAVLAILGNVLVCWAVWLNSNLQNVTNYFVVSLAAADIAVGVLAIPFAITISTGFCAACHGCLFIACFVLVLTQSSIFSLLAIAIDRYIAIRIPLRYNGLVTGTRAKGIIAICWVLSFAIGLTPMLGWNNCGQPKEGKNHSQGCGEGQVACLFEDVVPMNYMVYFNFFACVLVPLLLMLGVYLRIFLAARRQLKQMESQPLPGERARSTLQKEVHAAKSLAIIVGLFALCWLPLHIINCFTFFCPDCSHAPLWLMYLAIVLSHTNSVVNPFIYAYRIREFRQTFRKIIRSHVLRQQEPFKAAGTSARVLAAHGSDGEQVSLRLNGHPPGVWANGSAPHPERRPNGYALGLVSGGSAQESQGNTGLPDVELLSHELKGVCPEPPGLDDPLAQDGAGVS

Tag

N-terminal Flag-tagged and C-terminal Twin-Strep-tagged

Type

MP-Detergent Transmembrane Protein & Developed Protein

Source

Mammalian cell

Field of Research

Cancer

Relevance

Receptor for adenosine. The activity of this receptor is mediated by G proteins which activate adenylyl cyclase

Purity

Greater than 85% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.164.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

48.9 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Transmembrane Domains

7TM

Protein Length

Full Length

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Occludin (Marker of Early Blood Brain Barrier Damage) (OCLN/2181), CF568 conjugate, 0.1mg/mL
BNC682181-100 1x 100 µL

Occludin (Marker of Early Blood Brain Barrier Damage) (OCLN/2181), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
SOX4 (Master Regulator of Epithelial-Mesenchymal Transition) (SOX4/2540), CF405S conjugate, 0.1mg/mL
BNC042540-500 1x 500 µL

SOX4 (Master Regulator of Epithelial-Mesenchymal Transition) (SOX4/2540), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
EDG1 (S1PR1) Rabbit Polyclonal Antibody
AP01462PU-N 100 µg

EDG1 (S1PR1) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
katanin p80 (KATNB1) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI5A10]
TA503807AM 100 µL

katanin p80 (KATNB1) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI5A10]

Sign In for Pricing
View Details
SLFN12 (C-term) Rabbit Polyclonal Antibody
AP23570PU-N 50 µg

SLFN12 (C-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
QuicKey Pro Mouse EGFR (Epidermal Growth Factor Receptor) ELISA Kit
E-OSEL-M0021-01 24 Tests

QuicKey Pro Mouse EGFR (Epidermal Growth Factor Receptor) ELISA Kit

Sign In for Pricing
View Details