Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Adenosine receptor A2a (ADORA2A) -Detergent

Product Specifications

Abbreviation

Recombinant Human ADORA2A protein-Detergent

Gene Name

ADORA2A

UniProt

P29274

Expression Region

1-412aa

Organism

Homo sapiens (Human)

Target Sequence

MPIMGSSVYITVELAIAVLAILGNVLVCWAVWLNSNLQNVTNYFVVSLAAADIAVGVLAIPFAITISTGFCAACHGCLFIACFVLVLTQSSIFSLLAIAIDRYIAIRIPLRYNGLVTGTRAKGIIAICWVLSFAIGLTPMLGWNNCGQPKEGKNHSQGCGEGQVACLFEDVVPMNYMVYFNFFACVLVPLLLMLGVYLRIFLAARRQLKQMESQPLPGERARSTLQKEVHAAKSLAIIVGLFALCWLPLHIINCFTFFCPDCSHAPLWLMYLAIVLSHTNSVVNPFIYAYRIREFRQTFRKIIRSHVLRQQEPFKAAGTSARVLAAHGSDGEQVSLRLNGHPPGVWANGSAPHPERRPNGYALGLVSGGSAQESQGNTGLPDVELLSHELKGVCPEPPGLDDPLAQDGAGVS

Tag

N-terminal Flag-tagged and C-terminal Twin-Strep-tagged

Type

MP-Detergent Transmembrane Protein & Developed Protein

Source

Mammalian cell

Field of Research

Cancer

Relevance

Receptor for adenosine. The activity of this receptor is mediated by G proteins which activate adenylyl cyclase

Purity

Greater than 85% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.164.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

48.9 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Transmembrane Domains

7TM

Protein Length

Full Length

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Docosahexaenoic Acid
TRC-D494500-50MG 50 mg

Docosahexaenoic Acid

Sign In for Pricing
View Details
RFC2 (NM_002914) Human Over-expression Lysate
LY419017 100 µg

RFC2 (NM_002914) Human Over-expression Lysate

Sign In for Pricing
View Details
PKR (EIF2AK2) Rabbit Polyclonal Antibody
AP02776PU-N 100 µL

PKR (EIF2AK2) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
TNFAIP8L1 (NM_001167942) Human Over-expression Lysate
LY432649 100 µg

TNFAIP8L1 (NM_001167942) Human Over-expression Lysate

Sign In for Pricing
View Details
HMG20A Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI1C2]
TA807044AM 100 µL

HMG20A Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI1C2]

Sign In for Pricing
View Details
PAI-RBP1 / SERBP1 / SERPINE1 (SERBP1/3497), CF640R conjugate, 0.1mg/mL
BNC403497-100 1x 100 µL

PAI-RBP1 / SERBP1 / SERPINE1 (SERBP1/3497), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details