Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Activating signal cointegrator 1 complex subunit 3 (ASCC3)

Product Specifications

Product Name Alternative

ASC-1 complex subunit p200; Helicase, ATP binding 1; Trip4 complex subunit p200

Abbreviation

Recombinant Human ASCC3 protein

Gene Name

ASCC3

UniProt

Q8N3C0-3

Expression Region

1-111aa

Organism

Homo sapiens (Human)

Target Sequence

MALPRLTGALRSFSNVTKQDNYNEEVADLKIKRSKLHEQVLDLGLTWKKIIKFLNEKLEKSKMQSINEDLKDILHAAKQIEVNCPFQKRRLDGKEEDEKMSRASDRFRGLR

Tag

C-terminal 6xHis-tagged

Type

Developed Protein

Source

E.coli

Field of Research

Neuroscience

Purity

Greater than 85% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.162.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

19.9 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Isoform 2

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

C14orf178 siRNA (h)
sc-92424 10 µM

C14orf178 siRNA (h)

Sign In for Pricing
View Details
CEAcam8 Polyclonal Antibody, PerCP Conjugated
bs-0744R-PerCP 100 µL

CEAcam8 Polyclonal Antibody, PerCP Conjugated

Sign In for Pricing
View Details
Compound NP-024303
MBS5793038 Inquire

Compound NP-024303

Sign In for Pricing
View Details
SPP1 (Secreted Phosphoprotein 1, BNSP, BSPI, ETA-1, MGC110940, OPN) (AP)
MBS6163670-01 0.1 mL

SPP1 (Secreted Phosphoprotein 1, BNSP, BSPI, ETA-1, MGC110940, OPN) (AP)

Sign In for Pricing
View Details
SPP1 (Secreted Phosphoprotein 1, BNSP, BSPI, ETA-1, MGC110940, OPN) (AP)
MBS6163670-02 5x 0.1 mL

SPP1 (Secreted Phosphoprotein 1, BNSP, BSPI, ETA-1, MGC110940, OPN) (AP)

Sign In for Pricing
View Details
Rat Antigen-Presenting Glycoprotein CD1d (CD1D) Protein
abx065916-01 10 µg

Rat Antigen-Presenting Glycoprotein CD1d (CD1D) Protein

Sign In for Pricing
View Details