Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Activating signal cointegrator 1 complex subunit 3 (ASCC3)

Product Specifications

Product Name Alternative

ASC-1 complex subunit p200; Helicase, ATP binding 1; Trip4 complex subunit p200

Abbreviation

Recombinant Human ASCC3 protein

Gene Name

ASCC3

UniProt

Q8N3C0-3

Expression Region

1-111aa

Organism

Homo sapiens (Human)

Target Sequence

MALPRLTGALRSFSNVTKQDNYNEEVADLKIKRSKLHEQVLDLGLTWKKIIKFLNEKLEKSKMQSINEDLKDILHAAKQIEVNCPFQKRRLDGKEEDEKMSRASDRFRGLR

Tag

C-terminal 6xHis-tagged

Type

Developed Protein

Source

E.coli

Field of Research

Neuroscience

Purity

Greater than 85% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.162.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

19.9 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Isoform 2

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

1,1-Dimethylethyl 4-[3- (1-methylethyl) benzoyl]-1-piperidinecarboxylate
OR1101123-01 250 mg

1,1-Dimethylethyl 4-[3- (1-methylethyl) benzoyl]-1-piperidinecarboxylate

Sign In for Pricing
View Details
1,1-Dimethylethyl 4-[3- (1-methylethyl) benzoyl]-1-piperidinecarboxylate
OR1101123-02 1 g

1,1-Dimethylethyl 4-[3- (1-methylethyl) benzoyl]-1-piperidinecarboxylate

Sign In for Pricing
View Details
1,1-Dimethylethyl 4-[3- (1-methylethyl) benzoyl]-1-piperidinecarboxylate
OR1101123-03 5 g

1,1-Dimethylethyl 4-[3- (1-methylethyl) benzoyl]-1-piperidinecarboxylate

Sign In for Pricing
View Details
Interleukin 33 (IL33) Antibody
abx101206-01 100 µL

Interleukin 33 (IL33) Antibody

Sign In for Pricing
View Details
Interleukin 33 (IL33) Antibody
abx101206-02 200 µL

Interleukin 33 (IL33) Antibody

Sign In for Pricing
View Details
Interleukin 33 (IL33) Antibody
abx101206-03 1 mL

Interleukin 33 (IL33) Antibody

Sign In for Pricing
View Details