Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Orthopoxvirus vaccinia Cell surface-binding protein OPG105 (D8L), partial

Product Specifications

Product Name Alternative

Carbonic anhydrase homolog

Abbreviation

Recombinant Orthopoxvirus vaccinia D8L protein, partial

Gene Name

D8L

UniProt

L7QJR5

Expression Region

1-261aa

Organism

Orthopoxvirus vaccinia

Target Sequence

MPQQLSPINIETKKAISNARLKPLDIHYNESKPTTIQNTGKLVRINFKGGYISGGFLPNEYVLSSLRIYWGKEDDYGSNHLIDVYKYSGEINLVHWNKKKYSSYEEAKKHDDGLIIISIFLQVSDHKNVYFQKIVNQLDSIRSANTSAPFDSVFYLDNLLPSTLDYFTYLGTTINHSADAAWIIFPTPINIHSDQLSKFRTLLSSSNHDGKPHYITENYRNPYKLNDDTQVYYSGEIIRAATTSPARDNYFMRWLSDLRET

Tag

N-terminal 6xHis-tagged

Type

Developed Protein

Source

E.coli

Field of Research

Others

Relevance

Binds to chondroitin sulfate on the cell surface to provide virion attachment to target cell

Purity

Greater than 95% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.155.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

37.0 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Partial

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Ep-CAM / CD326 (VU-1D9), CF568 conjugate, 0.1mg/mL
BNC680017-100 1x 100 µL

Ep-CAM / CD326 (VU-1D9), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD106 / VCAM1 (1.4C3), CF568 conjugate, 0.1mg/mL
BNC680149-100 1x 100 µL

CD106 / VCAM1 (1.4C3), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Von Willebrand Factor (3E2D10), CF568 conjugate, 0.1mg/mL
BNC680633-500 1x 500 µL

Von Willebrand Factor (3E2D10), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
ACTH (Adrenocorticotrophic Hormone) (AH26), CF568 conjugate, 0.1mg/mL
BNC680026-100 1x 100 µL

ACTH (Adrenocorticotrophic Hormone) (AH26), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
P53 (PAb122), CF640R conjugate, 0.1mg/mL
BNC400338-100 1x 100 µL

P53 (PAb122), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Prolactin (Pituitary Tumor Marker) (PRL/2642), CF594 conjugate, 0.1mg/mL
BNC942642-500 1x 500 µL

Prolactin (Pituitary Tumor Marker) (PRL/2642), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details