Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Mitochondrial fission 1 protein (FIS1), partial

Product Specifications

Product Name Alternative

FIS1 homolog; Tetratricopeptide repeat protein 11

Abbreviation

Recombinant Human FIS1 protein, partial

Gene Name

FIS1

UniProt

Q9Y3D6

Expression Region

1-122aa

Organism

Homo sapiens (Human)

Target Sequence

MEAVLNELVSVEDLLKFEKKFQSEKAAGSVSKSTQFEYAWCLVRSKYNDDIRKGIVLLEELLPKGSKEEQRDYVFYLAVGNYRLKEYEKALKYVRGLLQTEPQNNQAKELERLIDKAMKKDG

Tag

C-terminal 6xHis-tagged

Type

Developed Protein

Source

E.coli

Field of Research

Cancer

Relevance

Involved in the fragmentation of the mitochondrial network and its perinuclear clustering. Plays a minor role in the recruitment and association of the fission mediator dynamin-related protein 1 (DNM1L) to the mitochondrial surface and mitochondrial fission. May not be essential for the assembly of functional fission complexes and the subsequent membrane scission event. Also mediates peroxisomal fission. May act when the products of fission are directed toward mitochondrial homeostasis, mitophagy, or apoptosis. Can induce cytochrome c release from the mitochondrion to the cytosol, ultimately leading to apoptosis

Purity

Greater than 95% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.148.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

21.1 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Partial

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

FOXP3 (3G3), CF640R conjugate, 0.1mg/mL
BNC400645-100 1x 100 µL

FOXP3 (3G3), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Fibronectin (HFN7.1), CF740 conjugate, 0.1mg/mL
BNC740270-500 1x 500 µL

Fibronectin (HFN7.1), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Mucin 1 / EMA / Episialin / CD227 (VU-2G7), CF640R conjugate, 0.1mg/mL
BNC400630-100 1x 100 µL

Mucin 1 / EMA / Episialin / CD227 (VU-2G7), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD86 (BU63), CF594 conjugate, 0.1mg/mL
BNC940193-100 1x 100 µL

CD86 (BU63), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD59 (heavy chain of Protectin) (BRA-10G), CF740 conjugate, 0.1mg/mL
BNC740181-500 1x 500 µL

CD59 (heavy chain of Protectin) (BRA-10G), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Calnexin (Endoplasmic Reticulum Marker) (CANX/1541), CF488A conjugate, 0.1mg/mL
BNC881541-100 1x 100 µL

Calnexin (Endoplasmic Reticulum Marker) (CANX/1541), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details